KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO0891Help
Entry
YPO0891           CDS       T00063                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Brite
Enzymes [BR:ype01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     YPO0891 (dsbC)
Secretion system [BR:ype02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   YPO0891 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(976288..977004)
Genome map
AA seq 238 aa AA seqDB search
MKKSLLLLPMLMAALSGVANADDSAIQQTLKKLDIQQADIQPSPIPGISTVMTESGVLYI
SADGKHLLQGPLYDVSGDQPINVTNQALLKKLEALSSEMIVYKAPEEKHVITVFTDITCG
YCRKLHEQMKDYNALGITVRYLAFPRQGLSSQAEKDMRSIWCMADRNKAFDDAMKNNDIS
PATCKTDISKHYQLGVQFGIQGTPAIVLQNGTIVPGYQGPKEMLQMLNAHQASLKAGG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagtttattgctgctgccaatgttaatggctgcattatcgggggttgctaat
gcagatgattctgctattcagcaaaccttaaaaaaattagatatccaacaagctgatatc
cagccgtcacctatcccaggcattagtacggtgatgaccgaaagcggcgtgctctatatc
tcagcagatggtaaacatctgctgcaagggccgctgtatgacgtgagtggcgatcagccc
atcaatgtgaccaatcaggcgttgctgaaaaaactggaagcattgagcagtgaaatgatt
gtgtataaagcacccgaggaaaaacacgtcattacggtgttcacagacattacctgcggc
tactgccgtaaattgcacgaacaaatgaaagattataatgcgcttggcatcactgttcgc
tatctggccttcccgcgtcaggggttaagctctcaggcggaaaaagacatgcgttctatc
tggtgtatggctgatcgtaataaagcctttgatgatgccatgaaaaataatgatatctcc
ccagcaacctgcaaaaccgatatcagcaagcattatcagctaggtgtgcaatttggtatc
cagggtacgccagctattgtgctgcaaaatggcactattgtcccaggctatcagggaccg
aaagaaatgctacagatgcttaatgcgcatcaggcttcactaaaagcgggtggttga

DBGET integrated database retrieval system