KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO1110Help
Entry
YPO1110           CDS       T00063                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype00020  Citrate cycle (TCA cycle)
ype00190  Oxidative phosphorylation
ype00650  Butanoate metabolism
ype01100  Metabolic pathways
ype01110  Biosynthesis of secondary metabolites
ype01120  Microbial metabolism in diverse environments
ype01130  Biosynthesis of antibiotics
ype01200  Carbon metabolism
Module
ype_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ype_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ype_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ype00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YPO1110 (sdhD)
   00650 Butanoate metabolism
    YPO1110 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    YPO1110 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-GeneID: 1173958
NCBI-ProteinID: YP_002346153
UniProt: Q7CH43
Position
1253771..1254118
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVITLYVFYILGFVVIVPDITYEIWRGFFASHITKVF
TLLTLLSILAHAWIGLWQVLTDYIKPLAIRLVLQLVVVITLLVYLLYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttagggcgtaatggagtacacgattggttgttactgcgt
gcttctgcaatcgtcatcaccctgtatgtcttttatattctgggcttcgttgtgattgtc
ccagacatcacctatgaaatctggcgcggtttcttcgcgtcacacatcacaaaagtattt
acgctgctgacattgctgtcgattctagctcacgcttggatcggtctatggcaggtattg
acggactatataaagccactggcgatacgactggtgttacaactggtcgtcgtgattacg
ctgttggtttatttattgtatggaacaattgtggtgtggggagcttaa

DBGET integrated database retrieval system