KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO1115Help
Entry
YPO1115           CDS       T00063                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype00020  Citrate cycle (TCA cycle)
ype00640  Propanoate metabolism
ype00660  C5-Branched dibasic acid metabolism
ype01100  Metabolic pathways
ype01110  Biosynthesis of secondary metabolites
ype01120  Microbial metabolism in diverse environments
ype01130  Biosynthesis of antibiotics
ype01200  Carbon metabolism
Module
ype_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ype_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ype00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YPO1115 (sucC)
   00640 Propanoate metabolism
    YPO1115 (sucC)
   00660 C5-Branched dibasic acid metabolism
    YPO1115 (sucC)
Enzymes [BR:ype01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     YPO1115 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 1173963
NCBI-ProteinID: YP_002346158
UniProt: Q8ZH00
Position
1261180..1262346
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KLVNSKEDIRAFAEQWLGKKLVTYQTDANGQPVHQILVEAATDIDKELYLGAVIDRSSRR
VVFMASTEGGVEIEKVAEETPELIHKIALDPLTGPQPYQGRELAFKLGLTGKQVGQFTKI
FMGLATLFLERDLAMVEINPLVVTKQGDLICLDGKLGADGNALFRQPELREMRDPSQEDA
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTDAAQQVVAAVGAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaatatcaggcaaaacaactgtttgctcggtatggcatgccagctcca
actggctacgcctgtaccactccgcgtgaagcagaagaagccgcatctaaaattggtgca
ggcccgtgggtggttaaatgtcaggttcatgcgggcggccgcggtaaagcggggggcgta
aaactggttaacagcaaagaagatattcgtgctttcgctgaacagtggctaggtaaaaaa
ctggtcacttaccaaacagatgccaacggacagccggtgcatcagatcttggttgaagca
gccacggatattgataaagaactgtatctgggggcggttatcgatcgcagctctcgccgt
gtggtctttatggcatccactgaaggtggtgttgaaattgaaaaagtcgccgaagagaca
cctgaactgatccataaaatcgcattagatccattgaccggaccacagccttaccaaggg
cgtgagctggcatttaaattgggcttgaccggtaaacaagtcggtcagttcaccaagatc
tttatggggctggcaacactgttcctggaacgtgacctggcgatggtagagattaacccg
ttggtggtcactaagcagggcgatctgatttgtctggatggtaagctcggtgccgatggc
aatgccttgttccgtcagccggaactgcgtgaaatgcgcgatccaagccaagaagatgct
cgcgaagcacatgctgcccagtgggaactgaactatgtggcgttagatggcaacatcggt
tgcatggtaaacggtgccggtttggcgatgggaaccatggacatcgtgaaacttcatggt
ggcgaacccgctaacttccttgatgtgggcggtggtgcaacaaaagagcgcgtgaccgaa
gcgttcaaaatcattctgtctgacgataaagtgaaagcggtttttgttaatatcttcggc
ggtatcgtgcgttgtgacctcattgctgacggcatcattggtgcagttgaagaagtgggc
gttaacgtacccgttgttgttcgtctcgaaggtaataatgcagagctgggtgccaagaaa
ctggcagacagcggtttgaatatcattgctgcgaccagcctgacagatgcggctcagcaa
gttgtagcggcagtgggggctaaataa

DBGET integrated database retrieval system