KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO1254Help
Entry
YPO1254           CDS       T00063                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ype00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1411511..1412947
Genome map
AA seq 478 aa AA seqDB search
MSYQQLPKDFLWGGAVAAHQVEGGWDKGGKGVSIADVLSGGSHGVDRVMTDGVLEGYRYP
NHEAVDFYSHYKEDIALFAEMGFKCFRTSIAWTRIFPHGDEQQPNEAGLQFYDDMFDELL
KYGIEPVITLSHFEMPWHLVKEYGGWKNRKVVDFFVKFSEVVMARYKSKVKYWMTFNEIN
NQRNWKYPLFGYCCSGVVFTEQENPEETLYQVLHHQFVASAKVVKLGHAINPEFKIGCMV
AMVPLYPFSCHPDDMMYSVEAMRERYLFGDVHMRGYYPSYILQEWARRGFNIHMEEGDLE
TLRDGCADYMGLSYYMSNAVSAINPGSGNSLSGFEGSVPNPHVKASDWGWQIDPVGLRYS
LSVLYERYQKPLFIVENGFGAIDKVAADGMVHDDYRIAYLKAHIEQMKKAVFEDGVDLMG
YTPWGCIDCVSFTTGEYSKRYGFIYVDKNDDGTGTMARSRKLSFDWYKKVIASNGEVL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagctatcaacagttaccgaaagattttttatggggtggcgcggttgcggcacatcag
gttgaaggcggctgggataaaggcggcaaaggcgtgagcattgctgatgtcctctctggt
ggctcccatggggttgaccgtgtgatgacagacggagtactggaagggtatcgttatcca
aaccatgaagcagttgatttttatagccattacaaagaagacatcgcgctgtttgccgaa
atgggcttcaaatgtttccgcacctcaattgcctggactcgtatcttcccgcatggcgat
gaacagcaacccaatgaagccggcctgcaattttatgacgatatgttcgatgaattgctg
aaatacggtattgaaccggtgattacgttatctcacttcgaaatgccgtggcatctggtc
aaagaatatggtggctggaaaaaccgtaaagtggtcgatttctttgtaaaattcagtgaa
gtcgtcatggcgcgctacaaaagcaaagttaaatattggatgaccttcaacgagataaat
aaccagcgtaactggaaatatccactgtttggttattgctgttctggtgtggtgttcact
gaacaagagaacccagaagagaccctgtatcaggtactgcatcatcagtttgttgccagt
gccaaagtggtcaagctgggtcatgccattaatccggaatttaagattggctgtatggtg
gcgatggtgcctctgtatcctttctcctgccatccagatgacatgatgtattccgttgaa
gctatgcgtgagcgttatcttttcggcgacgttcatatgcgcggttattacccttcatat
attttacaagagtgggcgcgccgtggtttcaatatccatatggaagagggggacctcgag
actctgcgtgatggttgcgccgattacatggggctgagttattacatgagtaacgcggtc
tctgcgattaatccaggtagcggcaattcactctctggttttgagggcagcgtgccgaac
ccacacgtcaaagcctctgattgggggtggcagattgatccggtaggtctgcgttactct
ctgagtgtgttgtatgaacgctatcagaagccgctatttattgttgaaaatggttttggt
gcgatagataaagtggcagcggatggcatggtgcacgacgactaccgcattgcttatcta
aaagcccatatcgagcagatgaaaaaagcggtatttgaagatggcgtggatctaatgggt
tataccccatggggatgtattgactgcgtatctttcactaccggtgaatacagtaaacgt
tatggctttatttatgtcgataaaaacgatgatggcaccggtacaatggcgcgttcacgt
aagttaagttttgattggtataaaaaagttattgccagcaatggtgaagttctttaa

DBGET integrated database retrieval system