KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO1505Help
Entry
YPO1505           CDS       T00063                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ype00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YPO1505 (folE)
Enzymes [BR:ype01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     YPO1505 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1708674..1709336
Genome map
AA seq 220 aa AA seqDB search
MSSLSKEAELVHQALLARGLETPLRKPELDAETRKTRIQAHMTEVMHLLNLDLTDDSLAD
TPRRIAKMYVDEIFSGLDYENFPKITLIQNKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILLALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgctaagtaaagaagctgagttggttcatcaagcgctgctggcccgtggtctt
gaaacccctttacgtaaaccagaattagatgccgagacgcgcaaaactcggattcaggcc
catatgacagaagtcatgcatttgctgaatcttgatttaaccgacgatagtctggctgat
acaccaagacgcattgcgaagatgtatgttgatgagattttctccggattggattacgaa
aatttccctaaaatcacactgattcaaaataaaatgaaagttgatgaaatggtaacggta
cgggatatcactctgaccagcacctgcgaacatcattttgtgacgattgatgggaaagcc
accgtcgcttatattccgaaagacagtgtcattggtttgtcgaaaatcaaccgtatcgtg
cagttttttgcgcagcgtccgcaagtgcaggaacgattaacacagcagatcttgctcgca
ttacaaaccctgttgggtaccaataatgtcgcagtttctattgatgcagttcattattgc
gttaaagcacgtggtatccgtgatgcgaccagcgcgacgaccaccacatcattaggcggg
ttatttaaatccagtcagaatacgcgtcaggaatttctgcgtgcggttcgtcaccacggc
tga

DBGET integrated database retrieval system