KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO1845Help
Entry
YPO1845           CDS       T00063                                 

Gene name
yedO
Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:ype00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YPO1845 (yedO)
Enzymes [BR:ype01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     YPO1845 (yedO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2089859..2090851
Genome map
AA seq 330 aa AA seqDB search
MTLQQKLTQFPRLDLVGNATPLEKLSRLSDYLGREIYIKRDDVTPVALGGNKLRKLEFLA
ADALRQGADTLVTAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTEQANYLTNGNRLLL
DLFNVDVVMCEALNDPNQQLAELATRVEAQGFRPYVVPIGGSNALGALGYVQCSLEIAAQ
AAGNVAFSSVVVASGSAGTHAGLAVGLQQLLPDAELIGVTVSRSADEQRPKVAQIQQALA
TSLGMTDPLAKITLWDSYFAPQYGMPNEEGIAAIKLLARLEGILLDPVYTGKAMAGLLDG
IEQQKFCDKGPILFIHTGGAPALFAYHPQV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcttcaacaaaaactgacgcaattcccgcgtctcgatctggtcggtaatgcgacg
ccattagaaaaactgtctcgtctatctgattatctgggacgtgaaatttacattaaacgt
gatgatgtcacgcctgtggcgcttggcgggaataaactgcgcaagctagaattcttagcc
gcagatgccttgagacagggagccgatacgctggttacggctggtgctattcaatctaat
catgtccgccaaaccgccgccgtggccgcgaaactggggctgcattgcgttgcgctgttg
gaaaaccccattggtactgagcaggcaaactatctgaccaatgggaaccggctgttactg
gacctattcaatgttgatgttgtgatgtgtgaggcattgaacgatccaaatcagcaatta
gcagaattggctacccgcgtggaagcgcagggtttccgcccatatgtggtaccgattggc
ggttctaatgccttgggcgcgctgggttatgtgcagtgctcactggaaattgctgctcaa
gccgcgggcaatgttgcgtttagttcggtcgtcgtggcctctggcagtgcgggaacacat
gcaggattggcggttggtctacagcagttgttacccgatgcggaattaatcggtgtgacg
gtatcacgtagtgccgatgaacagcggcctaaagtggcacagattcaacaagcgttggcg
acatcattagggatgacggacccattggcaaaaatcaccttgtgggatagttattttgcc
ccgcaatatgggatgccaaacgaagaggggatagcggctattaagctcttggcaagactg
gaaggaatattgttggaccctgtgtataccggtaaggcgatggcgggcttacttgatggt
attgaacagcaaaaattctgcgacaaagggccaattttatttatccacactggcggggca
cctgcgctgtttgcttatcatccgcaggtgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system