KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2014Help
Entry
YPO2014           CDS       T00063                                 

Gene name
ipk
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype00900  Terpenoid backbone biosynthesis
ype01100  Metabolic pathways
ype01110  Biosynthesis of secondary metabolites
ype01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ype00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YPO2014 (ipk)
Enzymes [BR:ype01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     YPO2014 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C DUF1127
Motif
Other DBs
NCBI-GeneID: 1174852
NCBI-ProteinID: YP_002347000
UniProt: Q8ZEY1
Position
complement(2286110..2287009)
Genome map
AA seq 299 aa AA seqDB search
MTTANQPICPSPAKWPSPAKLNLFLYITGQRADGYHQLQTLFQFLDYGDQLTIEPRDDNQ
IRLLTPIAGVENEQNLIVRAAKMLQKHPGNTPVPRGADISIDKCLPMGGGLGGGSSNAAT
VLVALNLLWQCGLTDEQLADLGLTLGADVPVFVRGHAAFAEGIGEKLQPAEPVEKWYLVI
HPGVNIPTPIIFSDPELKRNTPIRPLAALLSTPYANDCEPIARKRFREVEQALSWLLEYA
PSRLTGTGACVFAEFDTESSARQVLSIAPEWLHGFVARGVNVSPLHRVRSGKIESSERR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgcgaatcaacctatatgtccgtcaccagcaaaatggccgtcaccggcaaaa
ttgaatttgtttctttatatcaccgggcaacgcgccgacggctatcatcagttacaaacg
ctgtttcaatttcttgattatggtgatcaactgacgattgaaccgcgcgatgacaaccaa
attcgcttattaacccccatagcaggggtggaaaatgagcaaaacctgatcgtccgcgcg
gcaaaaatgctgcaaaaacaccctggcaatacccccgtgccacgcggtgctgatatcagc
attgataaatgtttaccgatgggcggtggattggggggcggttcgtctaatgcagccaca
gtcttggtggcactcaacctactgtggcaatgtggtttaactgatgaacaattagccgat
ctcggactaacattaggggctgatgtcccggtatttgttcggggccatgccgccttcgca
gagggtattggtgaaaaattacagccagcagagcctgtagagaagtggtatttggtcata
caccccggtgtaaacatcccaacaccgattattttttctgatcctgaattaaaaagaaat
acgccaatccgcccactggcggcgcttttaagcactccatacgcaaatgattgcgaaccg
atcgcaagaaaacgttttcgcgaggttgaacaggctctttcatggctgttagaatacgcc
ccgtcacgccttaccggtaccggcgcttgtgtgtttgcagaattcgacacggagtcatcg
gcccggcaggtgttaagtattgcccctgagtggttacatggttttgtcgcccgtggtgta
aatgtttcaccattgcatcgtgtacgctcagggaaaattgaaagcagtgagcgcagataa

DBGET integrated database retrieval system