KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2098Help
Entry
YPO2098           CDS       T00063                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2371306..2371818
Genome map
AA seq 170 aa AA seqDB search
MATIKRIASGSACAVAVIIAIVISAGNVRTSERGLELIGNAESCRRDPYACPAGVLTDGI
GNTHGVKAGVIKTDTQIAEDWEKNILDAERCVIRYANGNKLPPSAFDAATSISFNAGCSL
MQKSTMFKYFRAGNVTAACEQFPRWIYGGGKKLPGLVTRREKEKALCLES
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaataaaacgcattgcctccgggtctgcttgtgctgttgcagtcatcatcgcg
attgttatttcggcgggcaacgtaagaactagcgaacgaggacttgagctgatcggcaat
gctgaatcatgccgccgcgacccatacgcttgtccggctggagtactgactgatggcatt
ggcaacactcatggcgtcaaggctggagttattaagaccgacactcagatagccgaagat
tgggaaaagaacattcttgatgctgaacgctgcgtcattcgctatgcaaatggcaataaa
ttaccgcccagcgcttttgatgccgctacgtcaatcagctttaacgccggttgctcattg
atgcagaaatccacaatgttcaagtattttcgcgctggtaacgtgacagcggcctgtgaa
cagttcccgcgctggatatatggtggcggtaaaaaattgccggggctggtgactcgtcgc
gagaaggagaaggcgctatgcctggaaagttaa

DBGET integrated database retrieval system