KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2203Help
Entry
YPO2203           CDS       T00063                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype00260  Glycine, serine and threonine metabolism
ype00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ype01100  Metabolic pathways
ype01110  Biosynthesis of secondary metabolites
ype01130  Biosynthesis of antibiotics
ype01230  Biosynthesis of amino acids
Module
ype_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ype00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YPO2203 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YPO2203 (trpA)
Enzymes [BR:ype01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YPO2203 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NMO His_biosynth
Motif
Other DBs
NCBI-GeneID: 1175036
NCBI-ProteinID: YP_002347174
UniProt: Q8ZEH0
Position
complement(2477417..2478223)
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFKQLAAKKEGAFVPFVQLGDPSPAMSLNIIDTLIAAGADALELGIPFSDPLAD
GPTIQNAALRAFAAGVTPGICFEILAEIRQKHPTIPIGLLMYANLVFHNGIDHFYQRCAE
VGVDSVLIADVPFEESAPFRAAALRHGIAPIFICPPNADDDLLREIASHGRGYTYLLSRA
GVTGAENHGQLPLNHLVDKLREYNAAPALQGFGISEPAQVKASLAAGAAGAISGSAIVKI
IEKNVAQPVEMLVQLTRFVTEMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttatcagcaactttttaagcagttagccgccaaaaaagaaggtgcctttgtt
cctttcgtccagcttggcgatccctctccggcgatgtcactcaatattattgatacgtta
attgcggcaggtgcagatgcattagagttagggattccgttctctgatccgttggctgat
ggccctaccatacaaaatgcggcgctgcgtgcctttgctgcgggtgtcactccgggtatt
tgttttgaaatactggccgaaatccgccaaaaacaccccacaatacctattggcctgttg
atgtatgcaaatctggtattccacaatggtattgatcacttctaccagcgctgtgctgag
gtgggtgtcgattcggtgctaattgctgatgtgccatttgaagagtctgcccctttccgg
gcagcggccttacgtcacgggattgcacccattttcatctgcccgcctaatgccgacgat
gacttactgcgagaaatcgcttctcatggtcgtggttatacttacctgttatcacgtgcc
ggagtcaccggtgcagaaaatcacggccagttaccgttaaaccatctggtagataaactg
cgtgaatataatgcagcgcccgcattgcagggctttggtatttcagaacccgcgcaagta
aaagccagcctggcggcgggcgcggcgggtgctatttcaggctcagcaatcgtcaaaatc
attgaaaaaaatgttgcacaacccgttgaaatgttagttcagctaacccgcttcgtcaca
gagatgaaagcggcaacccgcagctag

DBGET integrated database retrieval system