KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2205Help
Entry
YPO2205           CDS       T00063                                 

Gene name
trpC
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ype00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YPO2205 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YPO2205 (trpC)
Enzymes [BR:ype01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     YPO2205 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     YPO2205 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2479570..2480997)
Genome map
AA seq 475 aa AA seqDB search
MQETGGYKTEGYNVGSDKVDSDKTKTVLHQIVHDKEIWVAARKLQQPLTRFQNEITQSQR
DFYHALQGDKTVFILECKKASPSKGVIRDNFNPAEIAGVYKHYASAISVLTDEKYFQGSF
DFLPQVSAAVTQPVLCKDFIIDAYQIQLARFYHADAILLMLSVLDDEAYRQLAAVAHSLN
MGVLTEASNAEELERAITLGAKVVGINNRDLRDLSIDLNRTRELAPRLPEGVTIISESGI
SHYRQVRELSQFANGFLIGSALMSEPDLNAAVRRVLLGENKVCGLTRAQDAATAYHAGAV
YGGLIFVDSSPRYVDIASARTVISGAPLKYVGVFRHAEIETVRQTAEQLSLAAVQLHGHE
DQQYINQLRKVLPADCQIWKALSVGDTMPERNLQQVERYVLDHGTGGTGQRFDWSLLADQ
ALDNVLLAGGLGPDNCDVAAQLGCAGLDVNSGVESAPGIKDPQRIAAVFQALRVY
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaactgggggttacaaaaccgagggttataacgttggcagtgacaaagttgac
agtgataaaaccaaaaccgtgctccaccaaatcgtacacgataaagaaatttgggttgcc
gcgcggaaactgcaacagcctctaacccgcttccaaaacgaaatcacccagagtcagcgc
gatttttatcacgcgctacaaggcgataaaacggtctttattttggaatgcaaaaaagcc
tcaccttctaaaggggttatccgtgacaactttaacccggcggagattgccggtgtttat
aagcactatgcgtcggctatctcagtattaacggatgagaaatatttccagggcagtttt
gatttcttgccacaagtcagtgccgccgtcactcagccggtattgtgtaaagattttatt
attgatgcttatcagattcagctagcgcggttttaccacgctgacgccattttactgatg
ctgtcggtcttggacgatgaggcttaccgccaattggccgccgtcgcacacagcctgaac
atgggggtgttgaccgaagccagtaacgccgaagaattggagcgtgctattaccttgggt
gccaaagttgttggcatcaataaccgcgacctgcgtgacctgtctatcgatctgaatcgc
acccgtgaattggcaccacgcctaccagaaggtgtcacaataatcagtgaatctggcatt
agtcattatcgtcaggtccgtgaattgagccaatttgccaacggtttcctgattggcagt
gccctgatgtccgaacccgatctcaacgcggccgtccgccgggtgttactgggcgaaaat
aaagtttgcggcctgacacgcgcacaagatgccgccacggcttaccacgcaggtgcggtg
tacggcgggttgatttttgtcgacagttcaccccggtatgtggatatcgccagcgcccgt
acggttatcagtggtgcgccgctaaagtatgtcggtgtttttcgtcatgctgaaatagaa
actgtacggcaaacggctgaacaactctcactggcagcagtgcaattgcatgggcatgaa
gatcaacagtatatcaatcaactgcgcaaagtattacctgcggattgccagatttggaag
gcactgagtgtcggtgacacgatgccggaacgcaacttacagcaagttgaacgctacgta
ttggatcacggtacgggtggcacagggcaacgtttcgactggtcattattggcagatcaa
gcactagataatgtcttgctggcaggcggcttggggccagataactgtgatgtggcagcc
caactaggctgtgccgggctggatgtcaattccggcgtagaaagcgcccctggcatcaaa
gacccccaacggatcgccgctgtattccaggcattacgcgtgtactga

DBGET integrated database retrieval system