KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2298Help
Entry
YPO2298           CDS       T00063                                 

Gene name
phoA
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ype00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ype00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ype02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2584182..2585627)
Genome map
AA seq 481 aa AA seqDB search
MNRVPTLSGIALSSGIALSTLLLSSALLTPNAIAAATGLYDRAAHGDVTQFGGARRLTED
QTQALRDSLSNKTVKNVILLIGDGMGDSEITSARNYAMGAGGFFKGIDALPLTGQYTHYA
LDKKTQKPNYVTDSAASATAWSSGVKTYNGALGVDVFGKDHVTLLELAKKAGKATGNVST
AELQDATPAAQFAHVTGRKCYGPEETSEKCSTNALEKGGRGSITEQMIEGRADVTLGGGA
ASFSQVAKAGEWKDQSLRDQALARGYVIVENLDDLNAIKHANQQKPLLGLFSPGNMPVRW
QGPKASYHGNLDKPPVVCENNAERTSDIPTLAVMTEKAIDLLKTNENGFFLQVEGASIDK
QDHSANPCGQFGETVDLDEAVQKALEFARADGNTLVIVTADHAHSSQIIEPEAKAPGLTQ
ALTTKDGAVMAISYGNSEDDSQGHTGSQLRIAAYGPHAANVVGLTDQTDLFFTMRDAMAL
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtgtacctactttatccggcatagcattatcatccggcatagcattatcgact
ctgttactgtccagtgcgctattaacgcctaatgcgattgcggctgctacgggcttatat
gaccgtgctgcgcatggtgatgtgactcaatttggcggcgcacgtcgtttgactgaagac
caaacccaggctctgcgtgactcgttatccaataaaacagtaaaaaatgtcattttgttg
attggagatgggatgggcgattctgaaatcacgtctgcccgtaactatgcgatgggggcc
ggtggtttctttaaaggcattgatgcgctgccgctgaccgggcaatacacgcactatgca
ctcgataaaaaaacacaaaaaccaaattatgtgactgattctgctgcatcagcgacggcc
tggtcatctggcgtaaaaacgtataatggtgcgttgggggttgatgtttttggtaaagac
catgttacgttgctggaactggccaaaaaagcaggcaaagcgacgggtaatgtctctacc
gctgaactacaagatgccactcctgctgcgcagtttgcccacgtgaccgggcgtaagtgc
tatggcccggaagaaaccagtgagaaatgcagtaccaatgcattggaaaaagggggccgt
ggctctattactgagcaaatgattgaagggcgcgctgatgtcacgcttggcggtggtgca
gcatcattcagccaggtcgctaaagccggtgagtggaaagaccagtcgttgcgtgatcag
gcgttggcccgcggctacgtcattgttgagaaccttgatgacctgaacgcaataaaacac
gctaatcaacagaaacctctattgggcttattctcgccaggtaatatgccagtgcgttgg
caggggccaaaagcctcttatcatggcaatctggataaaccgccagtggtgtgtgaaaac
aatgctgagcggaccagcgacattccaacgttggctgtcatgacagaaaaagccattgac
ctgctgaaaaccaatgagaatggcttcttcttgcaagttgaaggggcgtcgattgataaa
caggatcactccgctaacccatgtggtcagtttggtgaaacggttgatctggatgaagcg
gtacaaaaagcgctggaattcgcccgtgctgatggcaacactttggtgattgtgacggct
gaccatgctcactccagccaaattatcgagcctgaagcgaaggctccgggcctgactcag
gcattaacgaccaaagatggcgcggtcatggcgatcagctacggtaactctgaagacgat
tctcaaggccatactgggtcacaattgcggatagcggcttatggtcctcacgcggctaac
gtcgtaggtttaactgaccaaactgatttgttcttcaccatgcgggatgcgatggcactt
aaataa

DBGET integrated database retrieval system