KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2533Help
Entry
YPO2533           CDS       T00063                                 

Gene name
edd
Definition
(RefSeq) phosphogluconate dehydratase
  KO
K01690  phosphogluconate dehydratase [EC:4.2.1.12]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
ype00030  Pentose phosphate pathway
ype01100  Metabolic pathways
ype01120  Microbial metabolism in diverse environments
ype01200  Carbon metabolism
Module
ype_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ype00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YPO2533 (edd)
Enzymes [BR:ype01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.12  phosphogluconate dehydratase
     YPO2533 (edd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-GeneID: 1175364
NCBI-ProteinID: YP_002347494
UniProt: Q7CJ78
Position
complement(2842212..2844089)
Genome map
AA seq 625 aa AA seqDB search
MEMNPIITRVTQRIIARSAATRTAYLQRISAAKEHTVHRSQLACGNLAHGFAACQPEDKA
ALKNRVRSDIAIITSYNDMLSAHQPYEHYPQQLKDALHEVGAIGQVAGGVPAMCDGVTQG
QDGMELSLMSRDVIAMSAAIGLSHNMFDGALYLGVCDKIVPGLLMAALSFGHLPAIFVPA
GPMASGLPNKEKVRIRQLYAEGKVDRQALLEAEAASYHSAGTCTFYGTANSNQMVMEVMG
LHLPGASFIQPNTPLRDALTAAAARQITRLTETGINCIDGNHIDVNHINSSHINSSYLPV
GQLVDEKVVVNGIVALLATGGSTNHTLHLVAMARAAGIIINWDDFSELSEAVPQLCRIYP
NGPADINYFQASGGVALLVNMLLQGGLLHEEVHTVAGFGLQRYTQEPYLAAGKLQWRPGP
QQSLDATVIASLEQPFSAQGGTKVLNGNLGRAVMKTSAVPREHQVIEGPARVFESQHDVE
AAFESGDLDRDCVVVVRYQGPQAIGMPELHKLMPPLGVLLDRGFKVALVTDGRLSGASGK
VPSAIHVTPEAYCGGLLANVRNGDRIRVDGVSGELSLLVDEAELATRDSPLPAISAFHVG
CGRELFGALREQLSGAEQGACCIRF
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggagatgaaccccattatcacccgtgtcacgcagcgtatcattgcgcgctcagcggcc
acacgcacggcatatctgcaacgtatcagtgcagcaaaagagcataccgttcaccgttca
caactggcttgcggtaatctggcgcacggctttgcggcttgtcagccagaggataaagcg
gccctaaaaaatagggtgcgtagcgatatcgccatcattacgtcctataacgatatgctg
tctgctcatcaaccttatgaacattacccacaacaactgaaagacgcattgcatgaggtt
ggggccattgggcaggttgccggtggggttcctgccatgtgtgatggggtgacgcaaggg
caggatgggatggagttgtcgctaatgagccgcgatgtgattgctatgtcagcggctatt
ggcctgtcacacaatatgtttgatggtgctctctacctcggtgtgtgcgataaaatcgtt
cccggtttgttaatggcagcgctgtcatttggccatttaccggctatttttgtccccgcc
gggcctatggccagcggtttgcctaacaaagagaaagtccggatccgccaactttacgcc
gaggggaaagtggataggcaagccttgttggaggctgaagccgcttcgtatcacagtgcc
gggacctgtactttttacggtactgccaattctaatcagatggtgatggaagtgatgggg
ctgcatttgccgggagcctcttttatccaaccgaatacaccactgcgtgatgcgctgact
gcagcggcggcacgtcaaatcacccgtctgaccgaaaccggcattaattgtattgatggc
aatcatattgatgttaaccatatcaacagtagccatatcaacagcagctatttgcctgtt
ggccaattggtggatgaaaaagtggtcgtcaatgggattgtcgcgctgctggcaaccggc
ggttcgactaatcacaccttacatttggtcgcgatggcgcgggcggcgggcatcatcatt
aattgggatgatttctctgaactgtcggaagcggtgccgcagctatgccgtatttaccct
aatggcccagcggacatcaactattttcaggcatcgggtggtgtggcactgctggttaat
atgctattgcaaggcggtttactgcacgaagaggtgcataccgtcgctggatttggtttg
cagcgttatacgcaagagccttatctggcggcgggtaaattgcaatggcgtcctgggccg
caacagtcactggatgcgacggtgatcgccagtctggaacagcctttttctgctcagggg
gggacgaaagtattaaacggcaatctggggcgggcggtaatgaaaacctcggcagtgcca
cgggagcatcaggttattgaagggccagcgcgggtatttgagagtcagcatgatgtggaa
gccgcctttgaatccggtgatttggatcgcgattgtgtggtggtggtgcgttatcagggg
ccgcaggccattggtatgccggagttacataagctgatgccgccgctaggagtattactt
gatcgtggctttaaggtagcgttggtgacggatggccgattatccggcgcatcaggcaag
gtgccgtctgccattcacgtgacgccagaagcctattgcggtggtttactggccaacgtc
cgcaatggtgaccggattcgggttgatggggtcagtggcgagctgtcattactggtggat
gaggctgaattggccactcgcgatagtccgttaccggctatctctgctttccatgtggga
tgtggccgtgagttgtttggggcattacgtgaacagctttctggtgcagagcagggggcg
tgttgtattcgtttctaa

DBGET integrated database retrieval system