KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2533Help
Entry
YPO2533           CDS       T00063                                 

Gene name
edd
Definition
phosphogluconate dehydratase (EC:4.2.1.12)
Orthology
K01690  
phosphogluconate dehydratase [EC:4.2.1.12]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ype01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ype00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2842212..2844089)
Genome map
AA seq 625 aa AA seqDB search
MEMNPIITRVTQRIIARSAATRTAYLQRISAAKEHTVHRSQLACGNLAHGFAACQPEDKA
ALKNRVRSDIAIITSYNDMLSAHQPYEHYPQQLKDALHEVGAIGQVAGGVPAMCDGVTQG
QDGMELSLMSRDVIAMSAAIGLSHNMFDGALYLGVCDKIVPGLLMAALSFGHLPAIFVPA
GPMASGLPNKEKVRIRQLYAEGKVDRQALLEAEAASYHSAGTCTFYGTANSNQMVMEVMG
LHLPGASFIQPNTPLRDALTAAAARQITRLTETGINCIDGNHIDVNHINSSHINSSYLPV
GQLVDEKVVVNGIVALLATGGSTNHTLHLVAMARAAGIIINWDDFSELSEAVPQLCRIYP
NGPADINYFQASGGVALLVNMLLQGGLLHEEVHTVAGFGLQRYTQEPYLAAGKLQWRPGP
QQSLDATVIASLEQPFSAQGGTKVLNGNLGRAVMKTSAVPREHQVIEGPARVFESQHDVE
AAFESGDLDRDCVVVVRYQGPQAIGMPELHKLMPPLGVLLDRGFKVALVTDGRLSGASGK
VPSAIHVTPEAYCGGLLANVRNGDRIRVDGVSGELSLLVDEAELATRDSPLPAISAFHVG
CGRELFGALREQLSGAEQGACCIRF
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggagatgaaccccattatcacccgtgtcacgcagcgtatcattgcgcgctcagcggcc
acacgcacggcatatctgcaacgtatcagtgcagcaaaagagcataccgttcaccgttca
caactggcttgcggtaatctggcgcacggctttgcggcttgtcagccagaggataaagcg
gccctaaaaaatagggtgcgtagcgatatcgccatcattacgtcctataacgatatgctg
tctgctcatcaaccttatgaacattacccacaacaactgaaagacgcattgcatgaggtt
ggggccattgggcaggttgccggtggggttcctgccatgtgtgatggggtgacgcaaggg
caggatgggatggagttgtcgctaatgagccgcgatgtgattgctatgtcagcggctatt
ggcctgtcacacaatatgtttgatggtgctctctacctcggtgtgtgcgataaaatcgtt
cccggtttgttaatggcagcgctgtcatttggccatttaccggctatttttgtccccgcc
gggcctatggccagcggtttgcctaacaaagagaaagtccggatccgccaactttacgcc
gaggggaaagtggataggcaagccttgttggaggctgaagccgcttcgtatcacagtgcc
gggacctgtactttttacggtactgccaattctaatcagatggtgatggaagtgatgggg
ctgcatttgccgggagcctcttttatccaaccgaatacaccactgcgtgatgcgctgact
gcagcggcggcacgtcaaatcacccgtctgaccgaaaccggcattaattgtattgatggc
aatcatattgatgttaaccatatcaacagtagccatatcaacagcagctatttgcctgtt
ggccaattggtggatgaaaaagtggtcgtcaatgggattgtcgcgctgctggcaaccggc
ggttcgactaatcacaccttacatttggtcgcgatggcgcgggcggcgggcatcatcatt
aattgggatgatttctctgaactgtcggaagcggtgccgcagctatgccgtatttaccct
aatggcccagcggacatcaactattttcaggcatcgggtggtgtggcactgctggttaat
atgctattgcaaggcggtttactgcacgaagaggtgcataccgtcgctggatttggtttg
cagcgttatacgcaagagccttatctggcggcgggtaaattgcaatggcgtcctgggccg
caacagtcactggatgcgacggtgatcgccagtctggaacagcctttttctgctcagggg
gggacgaaagtattaaacggcaatctggggcgggcggtaatgaaaacctcggcagtgcca
cgggagcatcaggttattgaagggccagcgcgggtatttgagagtcagcatgatgtggaa
gccgcctttgaatccggtgatttggatcgcgattgtgtggtggtggtgcgttatcagggg
ccgcaggccattggtatgccggagttacataagctgatgccgccgctaggagtattactt
gatcgtggctttaaggtagcgttggtgacggatggccgattatccggcgcatcaggcaag
gtgccgtctgccattcacgtgacgccagaagcctattgcggtggtttactggccaacgtc
cgcaatggtgaccggattcgggttgatggggtcagtggcgagctgtcattactggtggat
gaggctgaattggccactcgcgatagtccgttaccggctatctctgctttccatgtggga
tgtggccgtgagttgtttggggcattacgtgaacagctttctggtgcagagcagggggcg
tgttgtattcgtttctaa

DBGET integrated database retrieval system