KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO2716Help
Entry
YPO2716           CDS       T00063                                 

Gene name
lepA
Definition
GTP-binding protein LepA
Orthology
K03596  
GTP-binding protein LepA
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3043412..3045211
Genome map
AA seq 599 aa AA seqDB search
MKHIRNFSIIAHIDHGKSTLSDRIIQICGGLSEREMAAQVLDSMDLERERGITIKAQSVT
LDYHSKDGQTYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAM
EMDLEVVPVLNKIDLPAADPERVAEEIEDIVGIDATDAIRCSAKTGVGVPDVLERLVRDI
PAPEGDPNGPLQALIIDSWFDNYLGVVSLIRIKNGSLRKGDKVKVMSTGQSYNADRLGIF
TPKRVDRDVLNCGEVGWLVCAIKDILGAPVGDTLTLTRNPAEKSLPGFKKVKPQVYAGLF
PISSDDYESFRDALGKLSLNDASLFYEPESSTALGFGFRCGFLGLLHMEIIQERLEREYD
LELITTAPTVVYEVITTNQETVYVDSPSKLPALNNIEELREPIAECHMLLPQEYLGNVIT
LCIEKRGTQTNMVYHGKQVALTYEIPMAEVVLDFFDRLKSTSRGYASLDYNFKRFQTSDM
VRVDVLINNERVDALALITHRDNAQYRGRDLVEKMKELIPRQQFDIAIQAAIGNHIIARS
TVKQLRKNVLAKCYGGDVSRKKKLLQKQKDGKKRMKQVGNVELPQEAFLAILHVGKDSK
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacataagaaacttttctattattgcccatattgaccacggtaagtcgacgctg
tctgatcggattattcagatctgtggcggtttatctgagcgtgaaatggccgcacaggta
ctggattccatggatctagaacgtgagcgtggtattaccatcaaggcacagagtgtgacg
cttgattaccattcgaaggatggtcaaacctatcaacttaactttatcgatacccccggc
catgttgacttctcttatgaagtttcacgctctttagccgcgtgtgaaggggctctattg
gttgtggatgcagggcaaggcgttgaggctcagacgctagcaaactgctacaccgcgatg
gagatggacctggaagttgttccggttctgaacaaaattgatttgcctgctgccgatcct
gagcgggttgctgaagaaatcgaagacattgtggggattgatgccactgatgcgattcgt
tgctcggcaaaaaccggtgtgggcgtgcctgatgttcttgagcggttggtccgcgatatt
ccagcccctgagggggatccaaatgggccattgcaggcattgattatcgattcctggttt
gataactacctgggtgttgtgtcattaatacgtatcaagaatggttcgttgcgtaaaggc
gataaagttaaggttatgagtaccggccagagctataacgcggatcgtttagggatattt
acaccaaaacgtgttgatcgtgatgttctgaactgcggcgaagtaggctggttggtttgt
gcaataaaagacattcttggcgcacctgttggcgatacattgacattaacgcgtaacccg
gcagaaaaatcattgcctggctttaagaaagtaaaaccacaagtttatgcgggcctgttc
ccgataagctctgatgattatgaatctttccgggatgcgttaggtaagttaagtcttaac
gatgcctctttgttctatgaaccagaaagctctacagcattaggctttggtttccgatgc
ggcttccttggcttgttacatatggagatcatccaggagcgtctggagcgtgaatatgat
ctggaactgattactacggcaccaacagtggtgtacgaggtgattacgactaatcaggaa
acggtctatgtcgatagcccttctaaactgcctgcgttgaacaatattgaagaactgcgc
gaaccgatcgctgaatgccatatgttgttgccacaggaatacctcggtaacgtcattaca
ttgtgtatcgaaaaacgtggtacacagaccaatatggtttatcacggtaagcaagtcgcg
ctgacatatgaaattccaatggcggaagtcgtgcttgatttctttgatcgtttgaaatca
acgtcacggggttatgcttcactggattataatttcaaacgcttccagacgtctgacatg
gtacgtgttgatgtattaatcaataacgaacgtgtggatgcgctggcactgatcacgcat
cgtgataatgcacaatatcgtggccgtgatttggttgagaaaatgaaagaactgatccca
cgtcaacaatttgatattgcgatccaggctgcgattggtaaccacatcattgctcgctca
acggtaaaacagctacgtaaaaacgtattggcgaagtgttatggtggggatgttagccgt
aagaaaaaacttctgcagaaacaaaaagacggtaagaaacgtatgaagcaagtcggtaac
gttgaattaccacaagaggccttcctggctattctgcatgttggaaaagacagtaaataa

DBGET integrated database retrieval system