KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO3120Help
Entry
YPO3120           CDS       T00063                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ype00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YPO3120 (recR)
DNA repair and recombination proteins [BR:ype03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      YPO3120 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3477960..3478565)
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEHCTICLNPRRQQNGQICVVESPADIHAIEQTGQFGGRYFVLMGHLSPMDGIGP
GDIGLDLLEKRLSTEAISEVILATNPTVEGDATANYIGQMCGQYGILASRIAHGVPVGGE
LEMVDGTTLSHSLAGRNPIKY
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccactcctggagtcattaatggaggcgttgcgttgtttaccgggtgtt
ggcccgaaatcggcgcaacgtatggcatttcagctattacagcgcgatcgtagtggtgga
atgcgcctggcgcaggctctgacacgggcaatgtctgaaataggccattgtgcagattgt
cgtacatttaccgagcaagagcactgcaccatctgcttgaatccccgccgtcaacaaaat
ggtcaaatctgtgtggtcgaaagcccggcagatatccatgccattgagcaaactggccag
tttggcgggcgttattttgtgctgatggggcatttatcacctatggatggtattggccct
ggtgatatagggctagatctactggagaaacggctttctactgaggctatcagtgaggtc
attttagccacgaatccaaccgttgaaggggatgcaacagccaactatatcggccagatg
tgtggccaatatggcatactggccagccgcatcgcccatggcgttcctgttggtggcgag
ttagaaatggttgatggcaccacgttatctcactcgttagcagggcgtaatcccatcaag
tactga

DBGET integrated database retrieval system