KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO3314Help
Entry
YPO3314           CDS       T00063                                 

Definition
hypothetical protein
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ype00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YPO3314
   01230 Biosynthesis of amino acids
    YPO3314
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YPO3314
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    YPO3314
Enzymes [BR:ype01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     YPO3314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3695798..3696628)
Genome map
AA seq 276 aa AA seqDB search
MNPYSLSIDELVRKARAIRRRIVLLNANSPAGGHTGADLSQVEILTALYFRILNCAPERL
TDPERDIYVQSKGHAVGGYYCCLAEARYFPEEWLATYQRADSHLPGHPVKHKTPGIELNT
GALGHGLPVAVGIALAAKRANSKRRVFVLTGDGELAEGSNWEAALVAAHYQLDNLVIIND
KNKLQLAGTTKSIMNTDPLADKWRAFGLQVTECRGNDMQSVVETLETLPQNGKPNVVIAN
TEKGAGISFIQGRVEWHHRVPKGAEIDLALEELNDE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgtattcactgtcaatcgatgagctggtgagaaaggcgcgggcgatccgccgc
cgtatcgtcctgcttaatgcgaacagccccgcaggtgggcataccggtgctgatctttcg
caggtagagattctgacggcactctattttcgtatcctcaattgtgcgccggagaggctt
acggatccggagcgcgatatctatgtgcaatctaaaggccatgcggttggcggctattat
tgctgtttggccgaagcccgttatttcccggaagagtggttggcgacttatcaacgtgcc
gactctcatctgccaggccaccctgtaaaacacaaaacgccaggcattgaactcaatacc
ggggctttagggcacggtttaccggtggcggttggtatcgcactggcggcaaaacgagcc
aacagcaaacgtcgggtctttgtcctgacaggtgatggcgaactggccgaaggcagcaac
tgggaagcagcgttagtggctgctcactatcaattagacaatctggtgatcatcaacgac
aaaaataaactgcaactggcagggaccactaaatcaattatgaataccgatccgctggca
gataaatggcgggcgtttggtctacaagtcactgaatgccgtgggaatgacatgcaatcg
gtggtggaaacactggagaccctaccacaaaacggtaaacccaatgtggtgatcgccaac
accgaaaaaggtgcggggatctcgtttattcaagggcgtgtggagtggcaccaccgggtg
ccaaaaggtgctgaaattgatctggcgctggaggaattaaacgatgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system