KEGG   Yersinia pestis CO92 (biovar Orientalis): YPO3314Help
Entry
YPO3314           CDS       T00063                                 

Definition
hypothetical protein
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
ype  Yersinia pestis CO92 (biovar Orientalis)
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:ype01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ype01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ype00030]
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of ansamycins
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3695798..3696628)
Genome map
AA seq 276 aa AA seqDB search
MNPYSLSIDELVRKARAIRRRIVLLNANSPAGGHTGADLSQVEILTALYFRILNCAPERL
TDPERDIYVQSKGHAVGGYYCCLAEARYFPEEWLATYQRADSHLPGHPVKHKTPGIELNT
GALGHGLPVAVGIALAAKRANSKRRVFVLTGDGELAEGSNWEAALVAAHYQLDNLVIIND
KNKLQLAGTTKSIMNTDPLADKWRAFGLQVTECRGNDMQSVVETLETLPQNGKPNVVIAN
TEKGAGISFIQGRVEWHHRVPKGAEIDLALEELNDE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgtattcactgtcaatcgatgagctggtgagaaaggcgcgggcgatccgccgc
cgtatcgtcctgcttaatgcgaacagccccgcaggtgggcataccggtgctgatctttcg
caggtagagattctgacggcactctattttcgtatcctcaattgtgcgccggagaggctt
acggatccggagcgcgatatctatgtgcaatctaaaggccatgcggttggcggctattat
tgctgtttggccgaagcccgttatttcccggaagagtggttggcgacttatcaacgtgcc
gactctcatctgccaggccaccctgtaaaacacaaaacgccaggcattgaactcaatacc
ggggctttagggcacggtttaccggtggcggttggtatcgcactggcggcaaaacgagcc
aacagcaaacgtcgggtctttgtcctgacaggtgatggcgaactggccgaaggcagcaac
tgggaagcagcgttagtggctgctcactatcaattagacaatctggtgatcatcaacgac
aaaaataaactgcaactggcagggaccactaaatcaattatgaataccgatccgctggca
gataaatggcgggcgtttggtctacaagtcactgaatgccgtgggaatgacatgcaatcg
gtggtggaaacactggagaccctaccacaaaacggtaaacccaatgtggtgatcgccaac
accgaaaaaggtgcggggatctcgtttattcaagggcgtgtggagtggcaccaccgggtg
ccaaaaggtgctgaaattgatctggcgctggaggaattaaacgatgagtaa

DBGET integrated database retrieval system