KEGG   Yersinia pestis Angola: YpAngola_A0045Help
Entry
YpAngola_A0045    CDS       T00635                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ypg  Yersinia pestis Angola
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ypg00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(52497..53120)
Genome map
AA seq 207 aa AA seqDB search
MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKRPGENHGEHYFFVSEK
EFCQMIDDDAFLEHAKVFENYYGTSRLAIEQVLATGVDVFLDIDWQGAQQIRAKMPTARS
IFILPPSKTELDRRLRGRGQDSEEVIAKRMEQAVSEMAHYAEYDYLIVNDDFNLALSDLK
TIIRAERLRLGRQKQRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaggtacgctatacatagtttccgcgcccagcggggcagggaaatcaagcctg
attcaggctttgttaaaaacacaaccgctgtacgacacgcaggtttcaatttcccatacc
acgcgtgctaaacgtccaggggagaatcacggcgagcattacttctttgtttctgaaaaa
gagttttgccagatgattgatgatgatgcttttcttgagcatgccaaagtatttgaaaat
tactacggtacctcacgtctggctattgagcaggttcttgcaaccggggttgatgtcttt
ttagatattgactggcaaggagcgcaacagattcgcgcaaaaatgccaaccgctcgcagt
attttcatcttgccgccatccaaaacagaattggatcgccgtttacgcggtcgtgggcag
gatagcgaagaagttatcgctaagcgtatggagcaagctgtctcagagatggcccattac
gcagagtatgattatttaatcgtaaatgatgatttcaatctggctttgtctgatctgaaa
accattattcgcgcagaacgactgcgtttaggccgccagaaacagcggcatgacgcttta
atcagcaaattattggcggactga

DBGET integrated database retrieval system