KEGG   Yersinia pestis Angola: YpAngola_A0045Help
Entry
YpAngola_A0045    CDS       T00635                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00230  Purine metabolism
ypg01100  Metabolic pathways
Module
ypg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    YpAngola_A0045 (gmk)
Enzymes [BR:ypg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     YpAngola_A0045 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 RsgA_GTPase AAA_22 ABC_tran AAA_18 AAA_33 MMR_HSR1 cobW Viral_helicase1 AAA_29
Motif
Other DBs
NCBI-ProteinID: ABX87022
Position
complement(52497..53120)
Genome map
AA seq 207 aa AA seqDB search
MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKRPGENHGEHYFFVSEK
EFCQMIDDDAFLEHAKVFENYYGTSRLAIEQVLATGVDVFLDIDWQGAQQIRAKMPTARS
IFILPPSKTELDRRLRGRGQDSEEVIAKRMEQAVSEMAHYAEYDYLIVNDDFNLALSDLK
TIIRAERLRLGRQKQRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaggtacgctatacatagtttccgcgcccagcggggcagggaaatcaagcctg
attcaggctttgttaaaaacacaaccgctgtacgacacgcaggtttcaatttcccatacc
acgcgtgctaaacgtccaggggagaatcacggcgagcattacttctttgtttctgaaaaa
gagttttgccagatgattgatgatgatgcttttcttgagcatgccaaagtatttgaaaat
tactacggtacctcacgtctggctattgagcaggttcttgcaaccggggttgatgtcttt
ttagatattgactggcaaggagcgcaacagattcgcgcaaaaatgccaaccgctcgcagt
attttcatcttgccgccatccaaaacagaattggatcgccgtttacgcggtcgtgggcag
gatagcgaagaagttatcgctaagcgtatggagcaagctgtctcagagatggcccattac
gcagagtatgattatttaatcgtaaatgatgatttcaatctggctttgtctgatctgaaa
accattattcgcgcagaacgactgcgtttaggccgccagaaacagcggcatgacgcttta
atcagcaaattattggcggactga

DBGET integrated database retrieval system