KEGG   Yersinia pestis Angola: YpAngola_A0088Help
Entry
YpAngola_A0088    CDS       T00635                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00010  Glycolysis / Gluconeogenesis
ypg00030  Pentose phosphate pathway
ypg00051  Fructose and mannose metabolism
ypg00052  Galactose metabolism
ypg00680  Methane metabolism
ypg01100  Metabolic pathways
ypg01110  Biosynthesis of secondary metabolites
ypg01120  Microbial metabolism in diverse environments
ypg01130  Biosynthesis of antibiotics
ypg01200  Carbon metabolism
ypg01230  Biosynthesis of amino acids
ypg03018  RNA degradation
Module
ypg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YpAngola_A0088 (pfkA)
   00030 Pentose phosphate pathway
    YpAngola_A0088 (pfkA)
   00051 Fructose and mannose metabolism
    YpAngola_A0088 (pfkA)
   00052 Galactose metabolism
    YpAngola_A0088 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    YpAngola_A0088 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    YpAngola_A0088 (pfkA)
Enzymes [BR:ypg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     YpAngola_A0088 (pfkA)
Protein phosphatases and associated proteins [BR:ypg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YpAngola_A0088 (pfkA)
Messenger RNA biogenesis [BR:ypg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     YpAngola_A0088 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABX86207
UniProt: A9R6A3
Position
90692..91675
Genome map
AA seq 327 aa AA seqDB search
MVKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGLYENRMKKLDRYSVSD
MINRGGTFLGSARFPEFRDPEVRKVALKNMHERGIDGLVVIGGDGSYAGADLLTKEGGIH
CVGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTL
AAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHAIVAITEKLDDIDSLAKYIEKET
GRETRGTVLGHIQRGGAPVAYDRILASRMGAYAVDLLLQDHDYKKGGFCVGVQNEKMVHE
LISVCIAPENKKSKFKEDWYDTAKKLF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaaaattggtgtcctaacaagtggtggtgatgcacccggtatgaatgctgct
attcgcggggttgttcgtgccgctttgtcagcagggttagacgttttcggtattgaagat
ggctatcttggcttatatgaaaatcgtatgaagaagctggatcgctatagcgtgtcagat
atgattaaccgtggcggtactttcctcggatctgctcgtttcccagaattccgcgatccg
gaagtgcgtaaagttgccctcaagaatatgcatgagcgtggcattgatggcttggttgtt
atcggtggtgatggttcttatgctggtgcggacctgctgacaaaagaagggggaattcac
tgtgttggtttaccgggcactatcgataacgatgtggcgggtactgactacaccatcggt
tttttcaccgcactggaaacggtagtggaagccattgaccgcttacgcgatacctcttct
tcccaccaacgtatctctatcgtggaagtgatgggccgctattgcggtgatttaacgttg
gcagccgcgattgccggtggttgtgagtttattgcgatccctgaagttgaatttaaacgt
gatgatctggttgctgaaatcaaagcgggcatcgcgaaaggtaaaaagcacgcgattgtt
gctattactgaaaagctggatgatatcgattcattggctaagtacattgaaaaagagacg
ggccgtgaaactcgtggcaccgtgttaggccatatccaacgtggtggtgctccggtggct
tatgaccgtattcttgcttcccgtatgggggcttatgctgtcgatttgctgttacaggac
cacgattacaaaaaaggtggtttctgcgtcggtgtacagaatgagaagatggtgcatgag
ttaatttctgtgtgtatcgcgccagagaataagaaaagtaaatttaaagaagattggtac
gatacagcgaagaaactgttctaa

DBGET integrated database retrieval system