KEGG   Yersinia pestis Angola: YpAngola_A0806Help
Entry
YpAngola_A0806    CDS       T00635                                 

Gene name
thrC
Definition
(GenBank) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ypg  Yersinia pestis Angola
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YpAngola_A0806 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YpAngola_A0806 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YpAngola_A0806 (thrC)
Enzymes [BR:ypg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     YpAngola_A0806 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(824561..825841)
Genome map
AA seq 426 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEIDKLLDLDFVTRSSRILS
AFIGSEIAPDVLTKRVQAAFEFPAPVAQVENDIAVLELFHGPTLAFKDFGARFMAQMLAE
VAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRGKISPLQEKLFCTLGGNIHTV
AIDGDFDACQALVKQAFDDEELKTALSLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLVNGQWQPKPTVATLSNA
MDVSQPNNWPRVEELYRRKIWQLKDLGHGAVSDKTTKDTMRELAGLGYISEPHAAIAYRV
LRDQLQDGEFGLFIGTAHPAKFKESVEAILGQELPLPKPLAVRAQLPLLSHDLPADFAQM
RAFLMA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataaccttaaagatcataacgagcaggtcagcttcgcacaggcgatcaaa
caaggcttgggcaaacagcaggggctatttttcccgttggagttgcccgagttcgaactg
actgagatcgataaactgctggatctggattttgtgacccgtagtagccgcattctgtcg
gcttttattggtagtgaaattgcaccagatgtcttaaccaaacgtgtgcaggcagctttt
gaattcccagcccctgttgcacaagttgaaaatgatatcgccgttctggagttgttccac
ggcccgaccttggcgtttaaagactttggcgcacgttttatggcacagatgctggccgaa
gttgctggcgatcaacccgtcactattttaacggcaacatcgggtgatactggtgcggcg
gtggctcatgcattctacgggctgaaaaatgttcgagtggttatcctttatccacgaggc
aagattagtccgctgcaagaaaagctgttttgtactctgggcggtaatattcacacggtg
gcgattgatggcgattttgatgcttgtcaggcactggttaagcaagcttttgatgatgaa
gaactgaaaaccgcgctgagtttgaattccgctaactcaattaatatcagccggttactg
gcacaaatttgttactactttgaagctgtagcccagttaccacaagaggcgcgcaaccaa
ctggttatctctgtaccaagcggtaactttggtgatttgactgccggtttgttggcaaaa
tctttagggctaccggtgaaacgctttattgctgccactaatgctaacgacaccgtgcca
cgctttttggttaacggccagtggcagccaaagccaactgtagccacgttatcgaatgcc
atggatgtcagtcagccaaataattggccacgtgtggaagagctatatcgtcgcaaaatc
tggcagttgaaggatttagggcatggtgcggttagcgataaaaccacaaaagatacgatg
cgtgaattagctggtttggggtatatctctgagcctcacgcggcgattgcttaccgtgta
ttgcgtgatcagttgcaagatggtgaatttggcttgtttatcggaaccgcacatcccgcg
aaattcaaagagagcgtagaggcaattctgggtcaggaattacctttaccaaaaccactg
gccgtgagagcgcaattaccgttgctatcccatgatttgcccgcagactttgcacaaatg
cgggcatttttgatggcatag

DBGET integrated database retrieval system