KEGG   Yersinia pestis Angola: YpAngola_A0830Help
Entry
YpAngola_A0830    CDS       T00635                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ypg  Yersinia pestis Angola
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YpAngola_A0830 (deoA)
Enzymes [BR:ypg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     YpAngola_A0830 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(853815..855230)
Genome map
AA seq 471 aa AA seqDB search
MHSRLKACCVAISESACGRLSSHIPVKQGDALFLAQEIIRKKRDGQPLSEEEIRFFINGI
RDNVVSEGQIAALAMTIYFHDMSMPERVALTMAMRDSGTVLNWKSLNLNGPLVDKHSTGG
VGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNAFRKIIQNV
GVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGA
FMPTYSLSADLAQAIVGVANGAGCKTTALLTDMNQVLASSAGNGVEVREAVRFLTGEYRN
PRLLEVTMALCVEMLLSGGLAHDEADARAKLQAVLDNGKAAEVFGRMVAAQKGPADFVER
YDSYLPVATLSKPVFAEQTGIITAMDTRALGMAVVALGGGRRRATDPIDYSVGLTEMARL
GTRVDGQQPLAVIHANNEDDWQQAAEVVRAAITVGNNTPEETPVIYRRITE
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtaggctgaaggcctgctgtgtcgctatttccgaaagcgcctgtgggcggctt
tcatcccatattccggtcaagcagggggatgccttgtttctggcacaagaaattatccgt
aaaaaacgcgacggtcagccattgagcgaagaagagattcgtttttttatcaatgggatc
cgcgataacgttgtttctgaagggcaaattgccgctttagcgatgaccatttatttccac
gacatgagcatgcctgagcgcgttgcgctgaccatggcgatgcgtgattccggtactgtg
ctgaattggaagagcctgaatctgaatggcccgctggtcgataagcactccactggtggc
gtgggtgatgtgacgtcactgatgcttggcccgatggtggcagcctgcggcggctatgtg
ccgatgatctctggccgtggtcttggtcataccggcggcacactggataaactggaggcg
atccccggttttgatattttcccggatgataatgcgttccgcaaaattattcagaatgtt
ggtgtggcgattatcggccaaaccagctcgctggcccctgccgataagcgtttttacgcg
acccgcgatattacggcaacagtcgattctattccattgattacggcctctattctggcc
aaaaaattggcggaagggctggatgcattggtcatggacgtgaaggtcggctccggtgcc
tttatgccaacctactcgttgtcggctgatttggcgcaggcgattgttggtgtggcaaac
ggtgcgggttgcaaaaccacggcgctactgacggacatgaaccaagtcctggcgtccagc
gccggtaatggggtcgaagtccgcgaagctgtgcgtttcctgacgggcgaatatcgcaac
ccacgtttgctggaagtgactatggcgctgtgtgttgaaatgttgctgtcaggcggttta
gcgcacgatgaagccgatgcccgtgccaagctgcaagccgttttggataatggcaaagcg
gcggaagtctttggccgtatggtggccgcgcaaaaaggcccggcagactttgttgaacgc
tatgacagctacctgcccgttgctaccctaagcaaaccggtatttgctgaacagacggga
atcattactgcaatggatacccgcgccttgggtatggcggtggtcgccctcggcggggga
cgccgtcgggcaacggatcccattgattatagtgtagggctgacggagatggcccgtttg
ggtacccgtgttgatgggcagcagccgcttgcggtgatccatgccaataacgaagatgac
tggcagcaggcggcagaggttgtgcgtgcggccatcaccgtagggaataacacgccagaa
gaaacgccagtgatttatcgccgtatcactgaataa

DBGET integrated database retrieval system