KEGG   Yersinia pestis Angola: YpAngola_A0907Help
Entry
YpAngola_A0907    CDS       T00635                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ypg  Yersinia pestis Angola
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    YpAngola_A0907
Enzymes [BR:ypg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     YpAngola_A0907
Exosome [BR:ypg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YpAngola_A0907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(928343..929785)
Genome map
AA seq 480 aa AA seqDB search
MSKFWGSVHGRVLAKASVPLQLEHPQPSWAEQDPLAIWLAVSQAVEGCLNQLAGAQVAGI
AISNQRESVLIWERETGTPLTPVVSWQCRRSEAFCLALRQLPAAAMVAERTGLQIDPLFP
AAKIHGMLAQIPHGAERAAHGELCVGTLDCWLTWQFSEGQSFSTDFSNAARTQLFNIHSG
QWDPDLLALFGIPSLCLPAVLPSASIHGHTARTGILGLEQGVPIVAHIGDSHAALYGQGG
DQAGEIKATYGTGSSLMMTLKQASAPSHGLSTTIAWHDGELRYALEGNITHTGSGVAWVS
RMLGISDLSRLTDMAESQSGNQGVYFVPALSGLGAPYWDSQARGLFCGLTDATTPAVLAR
AALESVAYQIADVFFAMENAAHHRLERLRVDGGATSNRWLMQFQADLLQRTLIRNHTAEV
SALGAAYLGGKTLGWWQDSQQLAALPREVEYIEPRIHSAEMQDNYSLWQTAIARARFQPK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagttttggggttcagtgcacgggcgagttctggcgaaagcctcggtaccatta
caactggagcatcctcagcccagttgggcagaacaggatccgctggcgatttggctggcg
gtttctcaggcggttgaggggtgcctaaatcaattggcgggcgcacaggtggcggggatt
gccatcagtaatcagcgtgaatcggtactgatttgggaacgggaaaccggcacgccgctc
acgccagtcgtaagctggcagtgccgtcgttcagaggctttctgtctggctttgcgccaa
ttaccggctgcggcgatggttgcggaacggactggattgcagattgatcccctgtttcct
gcggctaaaattcatggcatgttggcgcagatccctcatggcgctgaacgtgccgctcac
ggtgagctgtgtgttggcacgcttgattgctggctgacctggcagtttagcgaagggcaa
agtttctcgactgacttctctaatgcggcccggacccagctgtttaatatccattcaggt
caatgggaccccgatttactggcgctgtttggtatcccaagtctttgcctgcccgccgtc
ttaccctcggcatccatccacggacacaccgcgcgcaccgggattctcggcctggagcag
ggcgtgcctatcgtggcacacattggtgattcgcacgccgcgctgtacgggcaaggcggc
gaccaggccggtgaaatcaaagccacttatggcaccggctcctctctgatgatgacgcta
aaacaggccagtgcaccaagccacggcctaagcaccaccattgcctggcatgacggcgaa
ttacgttatgcccttgaaggtaacatcacccataccggctcaggagtggcatgggtctcg
cgcatgttagggatcagtgatttgtcacgtctgactgacatggcagaaagccaatcaggt
aatcaaggcgtctattttgtaccggcattatcaggactgggtgcgccttattgggacagt
caggcgcgtggtttgttctgtggtctgacggatgccacgacaccggccgtactggcgcga
gcggcacttgaatcagtcgcttatcaaatagccgatgttttctttgcgatggagaatgcg
gctcatcatcgccttgaacggctgcgggttgatggcggcgcgaccagtaatcgctggctg
atgcagtttcaggccgatttattgcagcgcacattgatacgtaatcacacggcagaagtg
tcagcactgggtgccgcgtatttgggcgggaaaacccttggctggtggcaggatagccaa
caactggctgcgctcccccgtgaagtggaatacatcgaaccgcgcattcacagtgcggag
atgcaagataactatagcctctggcaaacggccatcgcgcgtgcgcgttttcagccgaaa
taa

DBGET integrated database retrieval system