KEGG   Yersinia pestis Angola: YpAngola_A1009Help
Entry
YpAngola_A1009    CDS       T00635                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ypg  Yersinia pestis Angola
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YpAngola_A1009 (folK)
Enzymes [BR:ypg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     YpAngola_A1009 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
1033900..1034379
Genome map
AA seq 159 aa AA seqDB search
MIRVYIALGSNLAMPLQQVSAAREALAHLPRSRLVACSPLYRTKPLGPQDQPDFLNAVVA
LDTSLPPEQLLDHTQAIERNQGRVRKEQRWGPRTLDLDIMLYGDQVIKTDRLTIPHYGLK
AREFMLYPLADIAPDLIFPDGESLSECLKRVDKNGLVLW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatccgggtctatatcgcgctgggtagcaatttggccatgccactacaacaggttagc
gcggcacgggaagccttggcgcatctgccgcgtagccggttagtagcgtgttcgccactt
taccgcaccaagccattaggcccacaggatcaacccgattttctcaatgccgtggtcgca
ctggatacatcgttgccaccagagcagttgctggatcacacacaagcgattgaacgtaac
caaggccgggtgagaaaagagcagcgctgggggccacggacgctggatctggatattatg
ttgtatggcgatcaggtgataaaaactgatcgcctgacgattccgcattatggtctgaaa
gcgcgtgaatttatgctctatccactggcagatatcgccccagatcttattttccccgat
ggcgaatccctatcagaatgccttaagcgggtcgataagaacggcttggttctctggtaa

DBGET integrated database retrieval system