KEGG   Yersinia pestis Angola: YpAngola_A1009Help
Entry
YpAngola_A1009    CDS       T00635                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ypg  Yersinia pestis Angola
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ypg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
1033900..1034379
Genome map
AA seq 159 aa AA seqDB search
MIRVYIALGSNLAMPLQQVSAAREALAHLPRSRLVACSPLYRTKPLGPQDQPDFLNAVVA
LDTSLPPEQLLDHTQAIERNQGRVRKEQRWGPRTLDLDIMLYGDQVIKTDRLTIPHYGLK
AREFMLYPLADIAPDLIFPDGESLSECLKRVDKNGLVLW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatccgggtctatatcgcgctgggtagcaatttggccatgccactacaacaggttagc
gcggcacgggaagccttggcgcatctgccgcgtagccggttagtagcgtgttcgccactt
taccgcaccaagccattaggcccacaggatcaacccgattttctcaatgccgtggtcgca
ctggatacatcgttgccaccagagcagttgctggatcacacacaagcgattgaacgtaac
caaggccgggtgagaaaagagcagcgctgggggccacggacgctggatctggatattatg
ttgtatggcgatcaggtgataaaaactgatcgcctgacgattccgcattatggtctgaaa
gcgcgtgaatttatgctctatccactggcagatatcgccccagatcttattttccccgat
ggcgaatccctatcagaatgccttaagcgggtcgataagaacggcttggttctctggtaa

DBGET integrated database retrieval system