KEGG   Yersinia pestis Angola: YpAngola_A1381Help
Entry
YpAngola_A1381    CDS       T00635                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00020  Citrate cycle (TCA cycle)
ypg00190  Oxidative phosphorylation
ypg00650  Butanoate metabolism
ypg01100  Metabolic pathways
ypg01110  Biosynthesis of secondary metabolites
ypg01120  Microbial metabolism in diverse environments
ypg01130  Biosynthesis of antibiotics
ypg01200  Carbon metabolism
Module
ypg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ypg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YpAngola_A1381 (sdhD)
   00650 Butanoate metabolism
    YpAngola_A1381 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    YpAngola_A1381 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABX88624
Position
1437923..1438270
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVITLYVFYILGFVVIVPDITYEIWRGFFASHITKVF
TLLTLLSILAHAWIGLWQVLTDYIKPLAIRLVLQLVVVITLLVYLLYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttagggcgtaatggagtacacgattggttgttactgcgt
gcttctgcaatcgtcatcaccctgtatgtcttttatattctgggcttcgttgtgattgtc
ccagacatcacctatgaaatctggcgcggtttcttcgcgtcacacatcacaaaagtattt
acgctgctgacattgctgtcgattctagctcacgcttggatcggtctatggcaggtattg
acggactatataaagccactggcgatacgactggtgttacaactggtcgtcgtgattacg
ctgttggtttatttattgtatggaacaattgtggtgtggggagcttaa

DBGET integrated database retrieval system