KEGG   Yersinia pestis Angola: YpAngola_A1386Help
Entry
YpAngola_A1386    CDS       T00635                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00020  Citrate cycle (TCA cycle)
ypg00640  Propanoate metabolism
ypg00660  C5-Branched dibasic acid metabolism
ypg01100  Metabolic pathways
ypg01110  Biosynthesis of secondary metabolites
ypg01120  Microbial metabolism in diverse environments
ypg01130  Biosynthesis of antibiotics
ypg01200  Carbon metabolism
Module
ypg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YpAngola_A1386 (sucC)
   00640 Propanoate metabolism
    YpAngola_A1386 (sucC)
   00660 C5-Branched dibasic acid metabolism
    YpAngola_A1386 (sucC)
Enzymes [BR:ypg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     YpAngola_A1386 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABX87769
UniProt: A9R2F2
Position
1445332..1446498
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KLVNSKEDIRAFAEQWLGKKLVTYQTDANGQPVHQILVEAATDIDKELYLGAVIDRSSRR
VVFMASTEGGVEIEKVAEETPELIHKIALDPLTGPQPYQGRELAFKLGLTGKQVGQFTKI
FMGLATLFLERDLAMVEINPLVVTKQGDLICLDGKLGADGNALFRQPELREMRDPSQEDA
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTDAAQQVVAAVGAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaatatcaggcaaaacaactgtttgctcggtatggcatgccagctcca
actggctacgcctgtaccactccgcgtgaagcagaagaagccgcatctaaaattggtgca
ggcccgtgggtggttaaatgtcaggttcatgcgggcggccgcggtaaagcggggggcgta
aaactggttaacagcaaagaagatattcgtgctttcgctgaacagtggctaggtaaaaaa
ctggtcacttaccaaacagatgccaacggacagccggtgcatcagatcttggttgaagca
gccacggatattgataaagaactgtatctgggggcggttatcgatcgcagctctcgccgt
gtggtctttatggcatccactgaaggtggtgttgaaattgaaaaagtcgccgaagagaca
cctgaactgatccataaaatcgcattagatccattgaccggaccacagccttaccaaggg
cgtgagctggcatttaaattgggcttgaccggtaaacaagtcggtcagttcaccaagatc
tttatggggctggcaacactgttcctggaacgtgacctggcgatggtagagattaacccg
ttggtggtcactaagcagggcgatctgatttgtctggatggtaagctcggtgccgatggc
aatgccttgttccgtcagccggaactgcgtgaaatgcgcgatccaagccaagaagatgct
cgcgaagcacatgctgcccagtgggaactgaactatgtggcgttagatggcaacatcggt
tgcatggtaaacggtgccggtttggcgatgggaaccatggacatcgtgaaacttcatggt
ggcgaacccgctaacttccttgatgtgggcggtggtgcaacaaaagagcgcgtgaccgaa
gcgttcaaaatcattctgtctgacgataaagtgaaagcggtttttgttaatatcttcggc
ggtatcgtgcgttgtgacctcattgctgacggcatcattggtgcagttgaagaagtgggc
gttaacgtacccgttgttgttcgtctcgaaggtaataatgcagagctgggtgccaagaaa
ctggcagacagcggtttgaatatcattgctgcgaccagcctgacagatgcggctcagcaa
gttgtagcggcagtgggggctaaataa

DBGET integrated database retrieval system