KEGG   Yersinia pestis Angola: YpAngola_A1407Help
Entry
YpAngola_A1407    CDS       T00635                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00010  Glycolysis / Gluconeogenesis
ypg00260  Glycine, serine and threonine metabolism
ypg00680  Methane metabolism
ypg01100  Metabolic pathways
ypg01110  Biosynthesis of secondary metabolites
ypg01120  Microbial metabolism in diverse environments
ypg01130  Biosynthesis of antibiotics
ypg01200  Carbon metabolism
ypg01230  Biosynthesis of amino acids
Module
ypg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ypg_M00002  Glycolysis, core module involving three-carbon compounds
ypg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YpAngola_A1407 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    YpAngola_A1407 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YpAngola_A1407 (gpmA)
Enzymes [BR:ypg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YpAngola_A1407 (gpmA)
Membrane trafficking [BR:ypg04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    YpAngola_A1407 (gpmA)
Exosome [BR:ypg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YpAngola_A1407 (gpmA)
  Exosomal proteins of melanoma cells
   YpAngola_A1407 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABX88357
UniProt: A9R3B3
Position
complement(1463264..1464016)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRSEAKAAGKLLKDEGFTFDFAYTSVL
KRAIHTLWNILDELDQAWLPTEKTWKLNERHYGALQGLNKSETAEKYGDEQVKQWRRGFA
ITPPALEKSDERFPGHDPRYAKLTDAELPTTESLALTIERVIPYWNDVIKPRIASGERVI
IAAHGNSLRALVKYLDDLGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaactaagctagttttggtacgacacggcgaaagtcaatggaacaacgaaaac
cgcttcaccggttggtatgatgttgatctgtctgaaaaaggccgttctgaagcaaaggca
gcgggtaagctgttaaaagatgaaggcttcacttttgatttcgcctacacctcagtatta
aaacgcgctatccacaccttgtggaacattttggatgaattagatcaggcatggctgcca
acagaaaaaacctggaagcttaacgagcgtcactacggcgcactgcaaggcctgaataaa
tctgaaacggctgaaaaatacggcgatgagcaggttaagcaatggcgtcgtggctttgcc
atcacccctccagcactggagaaaagcgatgagcgtttcccaggccatgacccacgttat
gcaaaattgactgatgctgagctgccaaccacagaaagcttggcgctgactattgaacgc
gtgattccctactggaatgacgttatcaaaccacgtattgccagcggtgaacgcgtaatt
attgctgctcacggtaactctttacgtgcattggtaaaatatctggatgatctgggcgaa
gacgaaattcttgagctgaacatcccaactggcgtgccattagtgtatgagtttgatgag
aacttcaagcctatcaaacactactatctgggtaacgctgatgaaatcgccgctaaagct
gcagcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system