KEGG   Yersinia pestis Angola: YpAngola_A1912Help
Entry
YpAngola_A1912    CDS       T00635                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00071  Fatty acid degradation
ypg00280  Valine, leucine and isoleucine degradation
ypg00281  Geraniol degradation
ypg00310  Lysine degradation
ypg00362  Benzoate degradation
ypg00380  Tryptophan metabolism
ypg00410  beta-Alanine metabolism
ypg00640  Propanoate metabolism
ypg00650  Butanoate metabolism
ypg00903  Limonene and pinene degradation
ypg00930  Caprolactam degradation
ypg01040  Biosynthesis of unsaturated fatty acids
ypg01100  Metabolic pathways
ypg01110  Biosynthesis of secondary metabolites
ypg01120  Microbial metabolism in diverse environments
ypg01130  Biosynthesis of antibiotics
ypg01200  Carbon metabolism
ypg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YpAngola_A1912 (fadB)
   00650 Butanoate metabolism
    YpAngola_A1912 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    YpAngola_A1912 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    YpAngola_A1912 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YpAngola_A1912 (fadB)
   00310 Lysine degradation
    YpAngola_A1912 (fadB)
   00380 Tryptophan metabolism
    YpAngola_A1912 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YpAngola_A1912 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YpAngola_A1912 (fadB)
   00281 Geraniol degradation
    YpAngola_A1912 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YpAngola_A1912 (fadB)
   00930 Caprolactam degradation
    YpAngola_A1912 (fadB)
Enzymes [BR:ypg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     YpAngola_A1912 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YpAngola_A1912 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     YpAngola_A1912 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     YpAngola_A1912 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABX84950
UniProt: A9R754
Position
complement(1985086..1987275)
Genome map
AA seq 729 aa AA seqDB search
MLYQSETLQLHWLENGIAELVFDAPGSVNKLDTKTVANLGEALNVLEKQSELKGLLLRSA
KTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCEC
ILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIATGKDVTANDALK
IGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGRV
MQVAGKHYPAPLTAVKTIEAAAKFGRTEALNLETNSFVPLAGSNEARALVGIFLNDQYVK
AQAKKLSKGVAAPKLAAVLGAGIMGGGIAYQSALKSVPVIMKDINENSLDLGMNEAAKLL
NKQLERGKVDGLKMASILATIRPTLDYAGIERAQVIVEAVVENPKVKAAVLAEVEALIGE
DTVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGAKTSDKTLAAVVAY
ATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGGDFHQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDAKGKP
RKENDEQVDKLLAEISQPLQEFSDEDIIARTMIPMINEVVRCLEEGIIASAAEGDMALVY
GLGFPPFHGGVFRYLDTLGSANYVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPVAAAL
LDVSTNQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaagcgaaacattacagcttcactggttggaaaacggtattgccgagttg
gtatttgatgctccgggttcagttaataaactggatactaaaaccgtagccaatttgggt
gaagccttgaatgtgttagaaaaacaaagtgaactcaaagggttgctattacgttcagcg
aagacagccttgattgttggtgccgatattactgagtttctatccctgtttaatgcccca
ccagaaaaactgcaccagtggctggtgttcgccaacaccattttcaatcgactggaagat
ttacccgtgccaaccatttcagcaattaatggatacgcactaggtggaggatgtgaatgt
attttggcgacggatttccgtatcgcctccccagaagcacgtatcggcctcccagaaacc
aagttgggcatcatgccgggcttcggtggttcggtccgtttaccacgcctgctaggcgct
gatagtgcacttgagattattgccacaggtaaagatgttactgccaacgatgcactaaag
attgggctggttgatgcagttgtcgaccctgagaaactggtcggttcagccttaactatg
ctgaaacaagctattgacggtaagctcgattggcaggcagcacgccgcccaaaactggaa
cccctaaaacttaatcctaccgaagcggctatgtgttttaccattgctaaaggcagagtc
atgcaagtcgccgggaaacactatcccgcaccattgactgcagtaaaaactattgaagcc
gccgcaaaatttggtcgtaccgaagcgctgaacttggaaaccaacagttttgtcccttta
gcgggttccaatgaagctcgcgctttggtggggatttttcttaacgaccagtatgtaaaa
gcgcaagccaaaaaactgtccaaaggcgtcgctgcaccaaaactggctgcggttctgggc
gcagggatcatgggaggtggaattgcctatcagtcagcgctgaaaagtgtgccagtcatt
atgaaagatattaatgaaaactcgctggatcttggaatgaatgaggccgctaaattactg
aataaacagctggaacgcggcaaagtggatggccttaaaatggcaagtattctagcgact
attcgaccaaccttggattatgcaggtattgaacgagcccaagtgatcgtcgaagctgtg
gtggagaacccgaaggttaaagccgctgtacttgcggaagtagaagcattaatcggtgaa
gataccgttttagcttccaatacctcgacgattcctattgatcagttggctaaatcactc
aaacgccctgaaaatttctgcggtatgcacttcttcaatccagtacaccggatgccactg
gttgaaattattcgtggggcaaaaacctcagataaaacccttgcggcagtagtcgcttac
gctacacaaatggggaaaaccccaattgttgtcaatgattgccctggtttcttcgttaac
cgcgtcttattcccgtatctcgcaggctttggcatgttagtcagagacggtggggatttc
caccaaattgataaagtgatggaaaaacagtttggctggccgatggggcccgcttatcta
ttagatgtcgtcggtattgatactgcccatcatgcacaagcggtgatggctgccggtttc
cctgagcgaatgaacaaggattaccgtgatgcggttgatgtgatgtttgataaccaacga
tttgggcaaaagaatggtcaggggttttaccgctatacgcaagatgcaaagggtaagcca
cgtaaagaaaatgacgaacaagtggataaattactggcagaaatcagccaacctctccaa
gaattcagcgatgaagacattattgcccgcaccatgatcccaatgatcaatgaagtcgtc
cgctgcctggaagaaggtattattgccagcgcagccgagggtgacatggcgctggtttat
ggccttggcttccctccattccacggaggagtcttccgttaccttgatacgctcggtagc
gcaaattatgtcgaaatggctcaacgctatgcccaccttggtgcgttatatcacgttcct
gcggggctacgagctaaagctgaacataacgaaagttattatcctgtggcagcagcgctg
cttgatgtttctaccaatcaaccagcatga

DBGET integrated database retrieval system