KEGG   Yersinia pestis Angola: YpAngola_A2130Help
Entry
YpAngola_A2130    CDS       T00635                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ypg  Yersinia pestis Angola
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ypg00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ypg00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:ypg00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2225376..2226383
Genome map
AA seq 335 aa AA seqDB search
MPTDDSNNGIIDYVSTGHLPDPETVVKLVQEAHKRFSTDTAGVVSNVYPALERIPADLFG
ICMVGTNGKIHSAGDVDYEFTIMSVSKPFVFALVCQAIGAKTAREKLGVNSTGMAFNSVT
AIERASDGRTNPMVNSGAIATTSLVPGATSDEQWKFIYDGLCRFAGRELTLNEEVYQSAC
ETNFRNRGIANVLQGYGRLGCDPIIATDLYTRQCSLNVSARDLAVMGATLADGGVNPLTR
ERVVDNDICHYALAVMVTAGLYETSGDWLYDIGLPGKSGIGGGIVTVSPGKGGLGTFAPL
LDSAGNSIKGQLAARFLSRSLGMDMFVSEPYTEKN
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgccgacagatgatagcaataacggaattatcgactacgtatcaacaggtcatctacct
gacccggaaacagtcgttaaattagtgcaagaagcccataagcgatttagtacggatact
gctggtgtggtttctaatgtttatccggcattagagagaattcctgctgatctctttggc
atttgcatggttggcactaacggcaaaatccactctgctggcgatgtggattatgaattt
accattatgagtgtttccaaacccttcgtttttgcactggtttgtcaggctattggggcg
aagaccgcccgtgaaaaactcggggttaacagtaccggtatggcgtttaactcggtaacg
gccattgagcgggcatcggatggccgtacaaatccaatggttaactcgggtgcgattgcg
acgaccagtctggttcctggcgcgaccagtgatgaacaatggaaattcatttatgacggt
ttgtgccgctttgctggccgcgaattaacactgaatgaagaagtataccaatcggcttgt
gaaaccaatttccgtaatcgcggtatcgctaatgtgctgcaaggttatgggcgtctgggg
tgtgatcctattatcgccactgatctctatacccgccagtgttcactgaatgtcagtgcc
cgagatctggctgtgatgggcgcgacattagcggacggcggcgttaacccactgactcgt
gagcgagtggtggacaatgatatctgccattatgcattagccgtcatggtaacggcaggg
ctgtatgagacctctggagactggctctacgatattggcctgcccggtaaaagcggcatt
ggcggtggaattgtgacagtgtcacctggcaagggagggttggggacgttcgcaccgtta
ctcgacagtgcgggtaacagtatcaaagggcaacttgctgctcggttcttatcacgcagt
ctcgggatggatatgttcgtttctgagccttacaccgaaaagaattga

DBGET integrated database retrieval system