KEGG   Yersinia pestis Angola: YpAngola_A2317Help
Entry
YpAngola_A2317    CDS       T00635                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ypg  Yersinia pestis Angola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YpAngola_A2317 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YpAngola_A2317 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YpAngola_A2317 (trpA)
Enzymes [BR:ypg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YpAngola_A2317 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2433505..2434320
Genome map
AA seq 271 aa AA seqDB search
MERYQQLFKQLAAKKEGAFVPFVQLGDPSPAMSLNIIDTLIAAGADALELGIPFSDPLAD
GPTIQNAALRAFAAGVTPGICFEILAEIRQKHPTIPIGLLMYANLVFHNGIDHFYQRCAE
VGVDSVLIADVPFEESAPFRAAALRHGIAPIFICPPNADDDLLREIASHGRGYTYLLSRA
GVTGAENHGQLPLNHLVDKLREYNAAPALQGFGISEPAQVKASLAAGAAGAAGAISGSAI
VKIIEKNVAQPVEMLVQLTRFVTEMKAATRS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttatcagcaactttttaagcagttagccgccaaaaaagaaggtgcctttgtt
cctttcgtccagcttggcgatccctctccggcgatgtcactcaatattattgatacgtta
attgcggcaggtgcagatgcattagagttagggattccgttctctgatccgttggctgat
ggccctaccatacaaaatgcggcgctgcgtgcctttgctgcgggtgtcactccgggtatt
tgttttgaaatactggccgaaatccgccaaaaacaccccacaatacctattggcctgttg
atgtatgcaaatctggtattccacaatggtattgatcacttctaccagcgctgtgctgag
gtgggtgtcgattcggtgctaattgctgatgtgccatttgaagagtctgcccctttccgg
gcagcggccttacgtcacgggattgcacccattttcatctgcccgcctaatgccgacgat
gacttactgcgagaaatcgcttctcatggtcgtggttatacttacctgttatcacgtgcc
ggagtcaccggtgcagaaaatcacggccagttaccgttaaaccatctggtagataaactg
cgtgaatataatgcagcgcccgcattgcagggctttggtatttcagaacccgcgcaagta
aaagccagcctggcggcgggcgcggcgggcgcggcgggtgctatttcaggctcagcaatc
gtcaaaatcattgaaaaaaatgttgcacaacccgttgaaatgttagttcagctaacccgc
ttcgtcacagagatgaaagcggcaacccgcagctag

DBGET integrated database retrieval system