KEGG   Yersinia pestis Angola: YpAngola_A3354Help
Entry
YpAngola_A3354    CDS       T00635                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ypg  Yersinia pestis Angola
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YpAngola_A3354
Enzymes [BR:ypg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     YpAngola_A3354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3569111..3569275
Genome map
AA seq 54 aa AA seqDB search
MPEDIYFIVVENYSNDSKSLVLPAVYRDMVDQQPVQGSLTLAPWGSRVLTRYLE
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggatatttattttatcgtggtagaaaactacagtaatgacagcaaatcgctg
gtgttacctgcggtataccgcgatatggtcgaccagcagccggtacaaggtagcctgacg
cttgccccatggggaagccgagtgctaactcgctatctcgaataa

DBGET integrated database retrieval system