KEGG   Yersinia pestis Angola: YpAngola_A3751Help
Entry
YpAngola_A3751    CDS       T00635                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ypg  Yersinia pestis Angola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YpAngola_A3751 (malQ)
Enzymes [BR:ypg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     YpAngola_A3751 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3976517..3978613)
Genome map
AA seq 698 aa AA seqDB search
MDRKSLDQAATLAGIAASYINAHGKPQATLAETKEQLLAAMGRSLGAHDTQTANTPLPVV
KVFTFGSPMQLPMAGSGDYHWQLQTENGELHQGRISAKKTLTLPASLPLGYHRLILEQDL
QQWQCSIIVAPKRCYEPDALLQGKKLWGACVQLYTLRSEHNWGIGDFGDLKQMLEQVGER
GGSFIGLNPIHALYPANPHSASPYSPSSRRWLNVIYIDINRVEEFQQSEAAQRWWHQAET
QQALAKSRESEWVDYPLVMQLKLTALRLSFPLFTARKAKDAQVQAFRHFVEQGGSSLHQQ
AVFDALHAHLSEHDPMMWGWPVWPEKYRDGHSSAVADFCREHADEVTFYLWLQWLAASQF
DDCFQSSQQRKMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGL
PPMDPHVMVARAYQPFIDLLRANMTSCGALRIDHVMALLRLWWIPYGHTADQGAYVKYPV
DDLLAVLALESQRHHCMVIGEDLGTVPVEIVGKLRDSGVYSYKVLYFEHDSENIFRAPQS
YPVQAMATITTYDLPTLRGYWQADDLTLGNKLGLYPDQQILKQLYLDRERAKQGLLEGLH
RYDCVPKKVGHKAALLSMSPVLNRGLQRYVADSASALLGLQPEDWLDMAAPVNIPGTTDE
YPNWRRKLSASLEEIFADSQINRLLKDLDKRRKNVSVG
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtaaatcgctcgatcaagcagcaacactggcagggatagctgccagttacatt
aatgcgcatggtaaaccgcaggcgacgttagcggaaaccaaagagcagttgttggcggcc
atggggcgttctcttggtgctcatgacactcagacagcgaatacccctttgccggtcgtt
aaagtgtttacgtttggtagcccgatgcaattgccaatggccggttctggcgattatcac
tggcagttacagactgagaacggtgagctgcatcaggggcgtatcagtgcgaaaaaaacg
ctgacattgccggcctctttgccgctgggttatcaccgtttgatattggaacaagattta
cagcagtggcagtgttcaatcatcgtggcaccgaaacgctgctatgagcctgatgctttg
ctgcagggaaaaaaactgtggggggcttgcgtacaactgtataccctgcgttccgagcat
aattggggtatcggtgactttggtgatttaaagcagatgttagagcaggtcggtgagcgt
ggtgggtcctttatcggtttaaaccctatccatgcgttatatccggccaacccgcatagt
gctagcccttacagcccgtcatcccggcgctggttgaatgtgatttatatcgacatcaat
agggtcgaggagtttcagcaaagtgaagccgcgcagcgttggtggcatcaagctgagacg
caacaggcgttggcaaaaagtcgggagagcgagtgggttgattacccgttagttatgcag
cttaaattgacggctttgcgcttatccttcccactgtttactgcccgtaaagccaaagat
gcacaggtgcaggcatttcggcactttgttgaacaaggcgggagcagtttacatcagcag
gccgtatttgatgccctacatgcgcatttaagtgagcatgatccgatgatgtggggctgg
ccagtgtggccagagaagtaccgtgatggtcatagtagtgcggtggctgatttttgtcgc
gaacacgctgacgaggtgacgttctatctgtggttacagtggttggcagccagtcaattt
gatgactgcttccaatccagccaacagcggaaaatgccgattggtctgtatcgtgatttg
gcggttggggttgctgaaggtggcgctgaaacctggtgtgaccgcgagttatattgcctg
aaagcatcagtaggtgccccgccagatatcttggggccattaggccagaactgggggcta
ccgccgatggaccctcatgtaatggtcgcgcgcgcgtatcagccttttattgatttactg
cgtgccaatatgaccagttgtggcgcattgcgcatcgaccatgtcatggcattattgcgt
ctgtggtggatcccctacgggcataccgccgatcagggggcttatgtaaaatacccagtg
gatgatttgctggcggtattagcgctggagagtcagcgccaccattgcatggtgattggt
gaagatttaggcacggtaccggtagagattgtgggcaagttacgtgatagcggggtgtat
tcctacaaggtgctctattttgagcatgacagtgagaatatcttccgtgcgccacagtct
tacccggtgcaggcgatggcgaccattacgacctatgatttgccgacactgcgcggttac
tggcaagctgatgatctgactttggggaataagctggggttatatccggatcaacagatt
ttgaagcagctctatcttgacagagagcgagccaaacaagggttattagaagggttacat
cgttacgattgtgtgccgaaaaaagtgggccacaaagcggcactgttatcgatgagccca
gtactgaaccgtggtttgcagcgctatgttgcggatagcgccagtgcattgctggggtta
caaccagaagattggttggatatggcagcaccagtgaatatccccggtaccactgacgag
taccctaactggcggcgtaaattgtcagcgtctctggaagagatatttgccgatagccag
attaatcgtttattgaaagatttggataagcggcgcaaaaacgtttcggttgggtaa

DBGET integrated database retrieval system