KEGG   Yersinia pestis Angola: YpAngola_A3822Help
Entry
YpAngola_A3822    CDS       T00635                                 

Gene name
rpiA2
Definition
ribose-5-phosphate isomerase A (EC:5.3.1.6)
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
ypg  Yersinia pestis Angola
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YpAngola_A3822 (rpiA2)
   01230 Biosynthesis of amino acids
    YpAngola_A3822 (rpiA2)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YpAngola_A3822 (rpiA2)
Enzymes [BR:ypg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     YpAngola_A3822 (rpiA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4056269..4056925
Genome map
AA seq 218 aa AA seqDB search
MTQDELKKAVGWAALDYVKPGTIVGVGTGSTAAHFIDALGSIKHQIEGAVSSSDASTAKL
KSYGIPVFDCNDVDVLDIYVDGADEINGQMQMIKGGGAALTREKIIAAIARKFICIADES
KQVGVLGKFPLPVEVIPMARSYVARELIKLGGLPEYRQNVLTDNGNVILDVHNLSILDAI
ALENQINGIAGVVTVGLFANRGADVALIGTANGVKVIG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggatgaacttaaaaaagcggtgggctgggcagcattagattacgttaaaccc
ggtacgattgtgggtgtcggcacgggttcaactgcggcgcattttattgacgcgctaggc
tcgattaaacatcagatcgaaggggctgtttccagttctgatgcttcaaccgccaagctg
aaaagctatggtatcccagtatttgattgtaatgacgttgatgtattggatatctatgtt
gatggtgctgacgaaattaacggccaaatgcagatgattaaaggcggtggcgcagcactg
acccgagagaagattattgcggctatcgcccggaagtttatctgtattgctgatgaatcc
aaacaagttggtgtgctgggtaaattccccctgccagtcgaagtgatcccgatggcccgc
tcttatgtggcgcgtgagctgattaaattgggtggtttgcctgaataccgtcagaatgtc
ctgaccgataacggtaacgttattctggatgtccacaacttgagtattttggatgctatc
gctttagagaaccaaattaatggcattgccggtgtcgtaacggtggggctatttgcgaat
cgcggtgctgatgtggccctgattggtacggccaatggcgttaaagtgattggctaa

DBGET integrated database retrieval system