KEGG   Yersinia pestis Angola: YpAngola_A3919Help
Entry
YpAngola_A3919    CDS       T00635                                 

Definition
aspartate kinase III
Orthology
K00928  
aspartate kinase [EC:2.7.2.4]
Organism
ypg  Yersinia pestis Angola
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Methionine biosynthesis, apartate => homoserine => methionine
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:ypg01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ypg01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ypg00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ypg00270]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ypg00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4162184..4163569
Genome map
AA seq 461 aa AA seqDB search
MIQVAPQQTRDAPSATVVAKFGGTSVASFDAMSRSADVVLSNPDVRLVILSASAGITNLL
VALADGSEPEKRADHLEDIRHIQYDIIARLTDSTVIREEIDRMLENIAMLSEAASLATSP
ALTDELVSHGELMSTLLFVELLRQRQVAVEWFDVRKVMRTNDRFGRAEPDTSALAELAQT
LLAPRIEDAIVVTQGFIGSEGKGRTTTLGRGGSDYTAALLGEALNVSRIDIWTDVPGIYT
TDPRVVPAAKRIDKIAFEEAAEMATFGAKILHPATLLPAVRSDIPMFVGSSKDPAAGGTL
VCNETYNPPLFRALALRRKQTLLTLHSLNMLHARGFLAEVFNILARHSISVDLITTSEVS
VALTLDTTGSTSTGDSLLTTSLLTELSSLCRVEVEEDLALVAIIGNNLSQACGVGKEVFG
VLDPFNIRMICYGASSHNLCFLVPGNDADKVVQTLHYNLFE
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagtcgccccccaacagacccgcgatgcaccttctgcgactgtcgtcgccaaa
tttggcggcaccagcgtggccagttttgatgccatgagtcgtagcgccgatgtggtttta
tcgaacccggacgttcgtttggtgatcctttctgcgtctgccggtatcaccaatctgttg
gttgcccttgctgatggcagtgagccagaaaaacgtgcagaccatctggaggatattcgc
catattcaatacgatattattgccagactcactgattcgacggtgatccgcgaagaaatt
gaccgcatgttggaaaacattgccatgctgtctgaggcggccagtctggcgacctccccg
gccctgaccgatgagctggtcagccacggtgaattaatgtccaccctgctatttgtcgag
ctgttacgccaacgtcaggttgccgtggaatggtttgatgtgcgaaaagtcatgcgaacc
aatgaccgttttggccgcgcagagccagatacctcggccttggctgaactggcccaaaca
ctgctggcaccgcgtattgaagatgccattgtggtcacacaaggttttatcggcagcgaa
ggcaaaggccgaaccaccactctgggccgtggtggcagtgattacaccgccgcattgtta
ggtgaagcactgaatgtcagccgtatcgatatctggaccgatgtgccggggatatatacg
actgacccgcgtgtcgtcccggcagcaaaacgtatcgataaaatcgcctttgaagaagcg
gccgaaatggcaacctttggggcgaaaatcctgcatccggccactctgctaccggcagta
cgcagtgatatcccgatgtttgtcggctccagtaaagatcctgcggctggcggcaccttg
gtctgtaacgaaacctacaacccgccgctgttccgtgctctggcactacgccgcaagcag
acgctgttaactttgcacagcttaaatatgttgcatgcgcgcggttttctggcggaagtg
tttaatattctggcgcgccacagtatctccgtggatttaatcaccacgtctgaagtgagt
gtcgcgttaacattggataccaccggttcaacgtctaccggtgatagcctgctgaccacc
tcgttattgacggaactctcttccctgtgccgggttgaagtggaagaagatctggcgttg
gtggccattatcggcaacaacctgtctcaggcttgcggcgtcggtaaagaggtatttggt
gtcttggatccgttcaatattcgtatgatttgttacggtgccagcagccataatctgtgt
ttcctggtaccgggtaatgacgctgacaaagtcgtacaaacgctacattacaatttattt
gaataa

DBGET integrated database retrieval system