KEGG   Yersinia pestis Angola: YpAngola_A3947Help
Entry
YpAngola_A3947    CDS       T00635                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ypg  Yersinia pestis Angola
Pathway
ypg00010  Glycolysis / Gluconeogenesis
ypg00620  Pyruvate metabolism
ypg00640  Propanoate metabolism
ypg00680  Methane metabolism
ypg01100  Metabolic pathways
ypg01110  Biosynthesis of secondary metabolites
ypg01120  Microbial metabolism in diverse environments
ypg01130  Biosynthesis of antibiotics
ypg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YpAngola_A3947 (acsA)
   00620 Pyruvate metabolism
    YpAngola_A3947 (acsA)
   00640 Propanoate metabolism
    YpAngola_A3947 (acsA)
  Energy metabolism
   00680 Methane metabolism
    YpAngola_A3947 (acsA)
Enzymes [BR:ypg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     YpAngola_A3947 (acsA)
Lipid biosynthesis proteins [BR:ypg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   YpAngola_A3947 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABX88169
Position
4198585..4200543
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHPIPAAIAEHALITPEKYQHYYQQSVQNPDEFWGEQGKIIDWIKPYKTVKNTSF
DPGHVSIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDPNQSKTVTYKQLHHDVCQF
ANVLKSLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHS
KLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQRTGNASYWEDGRDVWWHDL
IKEASADCPPEEMNAEDPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNYPGVNRLSQVVDKHKVNILYTAPTA
IRALMAEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEGVAEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELYTEVRNWVRKEIGPLATPDILHWTD
SLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVEKLLEEKQSMQTPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatacataaacatcctattccagctgcaattgcagagcatgctctaattacc
ccagaaaaataccaacattattaccaacaatccgtgcagaaccctgatgaattctggggc
gaacaaggcaaaatcattgattggattaaaccctataaaacggtaaaaaatacctccttt
gaccccggtcatgtgagtatccgctggtttgaggacggtacattgaacctcgcggcgaat
tgccttgatcgccatttggcagagcgtggtgatcaaacagccatcatttgggaaggtgat
gaccctaatcaatcaaaaaccgtcacttataagcaactgcaccatgatgtgtgccagttt
gctaatgtcctaaaaagtttaggcgtcaaaaaaggcgatgtggttgccatctatatgcca
atggtgcctgaagctgccgtggcgatgttggcttgcgcgcgcatcggcgctgttcattcc
gttatctttggtggattttctccagatgccgttgccgggcgtatcatcgattctcactct
aaactggtgattactgccgatgaaggtatccgtgcaggccgtgctattccactgaaaaaa
aatgtcgatgaagcactgaaaaaccccgctatcaccagtattaaaaatgttgtggtcttc
caacgtactggtaacgccagctattgggaagatgggcgcgatgtatggtggcatgacctg
ataaaagaggcatccgctgactgcccgccagaagagatgaatgcagaagacccgctgttc
atcctttatacctctggctctaccggtaaacctaaaggggttgtacatacgacgggcggt
tatctggtttatgctgcactgacattcaaatatgtctttgattatcaccctggcgatatc
tactggtgtactgcagacgttggctgggtaaccggacacagctatctgttatatggacca
ctggcttgtggggccatcactctaatgtttgaaggcgtgcctaactaccctggcgtcaat
cgcttaagccaagttgttgataaacataaagtcaatattctatacaccgcgcctacagcg
attcgggccttaatggccgaaggtgacaaagccatcgaaggaaccaaacgcgactcactg
cgtattatgggatcggtcggcgagccgattaatccagaagcctgggaatggtattacaac
aagatcggtaacagtaaatgcccgattgtcgatacttggtggcagactgaaaccggtggt
ttcatgataacccctctgccgggtgccaccgagttgaaagccggttccgcaacgcgtcca
ttctttggggtacaacctgcgttggtagataacctgggcaatcctcaggaaggggtggca
gaaggtaatctggtcataaccgactcatggccggggcaagccagaacattatttggcgat
catgaacgtttcgaacaaacctacttctcaacctttaaaggcatgtatttcagtggcgac
ggcgcacgtcgtgacgaagacggttactactggataaccggtcgagttgatgacgtacta
aacgtttcaggccatcgcttaggaacggctgaaattgaatctgcattggttgcacacccg
aaaattgccgaagcggctgttgtcggtgttccacataatattaaaggacaggctatttat
gcctatatcacgctaaatcacggtgaagaaccaacgccagagttatataccgaagtacgc
aactgggtacgtaaagagattggcccactcgcaacacccgatattttgcattggacggac
tcattacccaaaacccgttcaggcaagatcatgcgccgtattttacgcaaaattgcgaca
ggagataccagcaacttgggcgatacctcaacacttgccgatccaagcgtggtagaaaaa
ttactagaagaaaaacaatcaatgcagacaccgtcgtaa

DBGET integrated database retrieval system