KEGG   Yersinia pestis Angola: YpAngola_A3986Help
Entry
YpAngola_A3986    CDS       T00635                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ypg  Yersinia pestis Angola
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ypg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4240563..4241396
Genome map
AA seq 277 aa AA seqDB search
MHLTARGLTLDLSRPQVMGILNVTPDSFSDGGCHNNLDQALQHAQRMLSAGATLIDIGGE
STRPGAAEVSEQEELDRVVPVVEALAQRFDVWLSVDTSKAAVITESAHAGAHLINDIRSL
QEPGALEAAAKTGLPVCLMHMQGQPKNMQHSPYYDDLMTDINRFFQHHIERCVAAGIAKN
KLLLDPGFGFGKNLAHNYQLLAHLSELHHFELPLLVGMSRKSMVGQLLNVPPQQRVIGSV
ACAAIAAMQGAQIIRVHDVKETVEAMCIVEATRSAKG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcatctaactgccagaggtctgacgttggatctctctcgtccacaagtcatgggtatt
ctgaatgtcacaccagattcattttcagatggtgggtgtcacaataaccttgatcaagca
ttgcaacatgctcaacggatgttatcagcaggcgctacgctgattgatatcggtggtgaa
tcaacgcgccctggggctgctgaagtcagtgagcaagaagaacttgatcgagtcgtgcct
gtggttgaggcgttagctcagcgttttgatgtgtggctctcggtagacacgtctaaagcc
gctgttatcactgaatctgctcatgcaggtgcccatctaattaatgatatccgctcgttg
caagagcctggcgctcttgaagcagcggcaaagactggcttaccggtgtgcctaatgcat
atgcaggggcaaccgaaaaatatgcagcattcaccctactatgatgatttaatgaccgat
ataaatcggttcttccaacatcatattgaacgctgtgttgcggcaggtatcgcaaaaaat
aaattgttgctcgacccaggcttcggtttcggtaaaaatctggcgcataattaccaacta
ttggcacatctgtcagagcttcaccattttgagttgccattattggtcggaatgtcgaga
aaatcgatggtaggccaattattgaatgtaccaccacaacagcgtgtcatcgggagtgtt
gcttgtgcggcgattgctgccatgcaaggtgcgcagattatcagagtgcatgatgtcaaa
gaaactgtcgaggcgatgtgtatcgtcgaggcaacacgttcagcgaagggataa

DBGET integrated database retrieval system