KEGG   Yersinia pestis Angola: YpAngola_A4118Help
Entry
YpAngola_A4118    CDS       T00635                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ypg  Yersinia pestis Angola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YpAngola_A4118 (glgB)
Enzymes [BR:ypg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     YpAngola_A4118 (glgB)
Exosome [BR:ypg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YpAngola_A4118 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4398623..4400806
Genome map
AA seq 727 aa AA seqDB search
MSVLPDRQVINQLISGHYGDPFSILGMHETSQGLQICALLPDAREVWLVETENGRRIAQL
TLEDPRGFFIAQLTRRKKSFRYQFAVTWQENPQIIEDPYRFGPLLQDIDSWLLAEGTHLR
PYERLGAHLMSLDGVSGVSFAVWAPNAQRVSVVGDFNFWDGRRHPMRLRRENGIWELFLP
GIEAGQLYKFEIIDCHGQVRLKADPYAFEAQMRPETASLISPLPDVVKSSAARQKANDLC
SPVSIYEVHLGSWRRHTDNNFWLSYRELADQLVEYVKYMGFTHVELLPINEHPFDGSWGY
QPLGLYAPTRRYGTPEDFKAFVAKFHQAGINVILDWVPGHFPSDEHGLSTFDGTALYEYA
DPREGYHQDWNTLIYNYGRNEVRNYLAGNAFYWMERFGIDALRIDAVASMIYRDYSRAEG
QWVPNYYGGRENLEAIAFLRYTNKTIGVERPGSVTMAEESTDFPGVTLPPDIGGLGFNYK
WNMGWMHDTLNYMQCDPVHRKYHHNLMTFGMLYAYTENFILPLSHDEVVHGKRSILDRMP
GDAWQKFANLRAYYAFMWAHPGKKLLFMGCEFAQGREWNFETSLDWHLLDDENGWHSGVQ
RLVRDLNHCYRQYAPLYEWDYQPAGFEWLVVDDHENSVFAFLRRDAEGHELIAISNFTPV
PRYHYRVGIPQGGHYREVLNSDSAFYCGSNLGNQGGIDSHHVRSHNHEHSLLLTLPPLAT
IYLLREN
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacttcccgatcgtcaggtgattaatcagcttatttccggccattatggcgac
cccttctccattttgggtatgcatgaaacctcgcaggggttgcagatttgtgcattgctg
ccagatgcccgagaagtctggctagtggagacagagaacgggcggcggatagcacaatta
acgctcgaagatccccgtggtttttttattgcacaactgactcgtcgtaagaaatccttc
cgctaccaatttgccgttacctggcaagagaacccacaaatcatcgaagatccttaccgt
ttcggtcccttattacaggatattgatagctggttattggctgaaggtacccatttacgc
ccttatgaacgtttgggggcgcatttaatgagccttgatggtgtatccggtgtcagtttt
gcggtttgggcaccgaatgctcagcgggtatccgtggtgggggattttaacttttgggat
ggccgccgccatccgatgcgcttacggcgtgaaaatggcatttgggagctatttctgcca
ggaatagaggcggggcagttgtataagtttgagatcattgattgccatggccaggtgcgt
ctgaaagctgacccttacgcttttgaagcgcagatgcggccagaaaccgcctcattgatt
agcccgctacccgatgtagtgaagagtagcgccgcacggcaaaaagccaatgatttatgt
tccccggtgtctatctatgaagtgcatctcggttcgtggcgtcggcataccgataataat
ttctggttgagttaccgcgaattggcggatcaactggtcgaatacgttaaatatatgggt
tttacccatgtcgagctgctgccgattaacgaacatccatttgacggtagctggggttat
cagccgctaggattatatgcaccgacccgccgttacggcaccccagaggatttcaaagcg
ttcgtcgccaaattccatcaggcaggaattaacgtgatccttgattgggttcccggccat
tttcccagtgatgagcatggattatcgaccttcgatggcactgcgttgtatgaatatgct
gatccgcgcgaagggtaccatcaggattggaataccctgatctataactatggccgtaac
gaagtccgtaactatctggcgggcaatgcattctactggatggaacgttttggcatcgat
gcgttgcgtattgatgcggtggcctcaatgatttaccgcgattatagccgtgctgaaggg
cagtgggtgcctaactattatggtggccgggaaaatttggaggctatcgctttcttgcgt
tacaccaataagaccattggcgttgaacgccccggcagtgtgaccatggcggaggagtca
accgactttcctggtgtgacattaccgcctgatattggtggcctgggtttcaactataaa
tggaacatgggttggatgcatgacacgctgaattatatgcaatgtgatcctgttcaccgc
aaataccaccataatttgatgacgttcggtatgttatacgcttataccgagaactttatc
ttaccgctctcccacgatgaagtggtccacggcaagcgctcgatacttgatcgtatgccg
ggtgatgcctggcagaaatttgccaacctacgggcttattacgcatttatgtgggcgcat
cccggtaaaaaactgctgtttatgggctgtgaatttgcgcaggggcgtgagtggaatttc
gaaaccagtctggattggcacctgctggacgatgaaaacggctggcattccggtgtgcag
cgtctggttcgtgaccttaaccattgctatcgccagtatgcgccgttgtatgaatgggat
tatcaacccgctggttttgaatggttggtggttgatgaccacgaaaattcggtattcgcc
ttcctgcgccgtgatgccgaggggcacgaactgattgctatcagtaatttcaccccggtt
ccacgttatcactaccgtgtgggcattccacaaggtggtcactaccgtgaagtgttgaat
tctgactctgcattttactgcggcagtaacctgggtaatcagggcggcattgatagccat
catgtgaggagccacaaccacgagcattcgttgttactcaccttgccaccgctggcaacg
atttacctgctgcgggagaactag

DBGET integrated database retrieval system