KEGG   Yersinia pestis Angola: YpAngola_A4161Help
Entry
YpAngola_A4161    CDS       T00635                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ypg  Yersinia pestis Angola
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ypg00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ypg00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4451080..4452399
Genome map
AA seq 439 aa AA seqDB search
MQSYFNELEQVRYEGSQSTNPLAFHHYNPDEMILGKRMADHLRFAACYWHTFCWGGADMF
GANAFDRPWQQPGDALALAKRKAKVAFEFFHKLNVPYYCFHDVDVSPEGASLQEYLNNFA
VMTDVLAEKQAASGVKLLWGTANCFTHPRYGAGAATNPDPEVFSWAATQVFTAMNATRQL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKTGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIASAIALGIFGSVDANRG
DPQLGWDTDQFPNSVEENTLVMFEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKFAAKMIEDGQLDQIVAKRYAGWNSELGQQILQGKMSLEELSRYASQHNLNPQ
HQSGHQELLENKVNRYLFG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcttattttaatgaattagaacaagtgcgctacgaaggtagccagagcacgaat
cctctggcgtttcatcattacaacccggatgaaatgatccttggtaagcgaatggctgac
catctgcggtttgccgcctgttactggcataccttctgctggggtggggccgatatgttc
ggtgccaatgcttttgatcgcccatggcaacaacctggggatgcactggctctggctaaa
cgcaaagccaaggttgcatttgaattcttccataaactgaatgtaccgtattactgcttc
catgatgtggatgtctcgccagaaggcgcgtcactacaggaatatctgaataacttcgcc
gtaatgaccgatgtactggctgaaaaacaagcagccagtggtgtgaaattattatggggc
acggctaactgctttacccatcctcgttatggtgctggtgccgcgaccaatcctgatcca
gaagtatttagctgggcagccacccaggtctttacggccatgaatgccacccgccaactc
ggcggtgaaaactatgtgttatggggcggacgtgaaggctacgaaacactgttgaatacc
gatttgcgacaagagcgtgaacaaattggccgctttatgcaaatggtcgtcgaacataaa
cacaaaacgggtttccaggggacactccttattgagccaaaaccgcaggagcccactaaa
catcaatacgattatgacgtcgcgacagtttacggcttccttaagcagttcggcttagaa
aaagagattaaagtcaatattgaagccaaccatgccacgctggcggggcactctttccat
cacgaaattgccagtgccatcgccttaggtatttttggctcagtggatgctaaccggggc
gatccgcaactgggctgggataccgatcaattcccaaacagtgtagaagaaaatacactg
gtgatgttcgagatcctcaaagcaggcggttttaccaccgggggcctgaattttgatgcc
aaagtgcgccgccaaagtaccgataaatatgatctgttctacggtcatattggcgcaatg
gacaccatggcactggcgctaaaatttgccgccaaaatgattgaagatgggcaattagat
cagatcgttgccaaacgttatgccggttggaatagcgagctgggccaacagatcctgcaa
ggtaaaatgtcgctggaagagctctcccgctatgccagtcaacataatctgaacccgcag
caccaaagcggtcatcaagagttgttggagaataaggttaaccgctatttatttggttga

DBGET integrated database retrieval system