KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_0403Help
Entry
YPC_0403          CDS       T01874                                 

Gene name
pldB
Definition
lysophospholipase L(2) (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:yph00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
380149..381162
Genome map
AA seq 337 aa AA seqDB search
MLLGHHMNNWLTREEQFAAFINGPLLDFWQQRDEQTFMGVDNIPIRYVRFRAPHHTQVVV
VVPGRIESYVKYPEVAYDLFQQGYDVIVLDHRGQGRSGRMLDDHNRGHVIKFDDYIEDFA
QLVQIEITGSHYQQRFALAHSMGGAILTRFLAREPDVFNAVALCAPMFGIHLPLPGWLAR
RIVNWAEGHQKLRDYYAIGTGHWRPLPYLVNMLTHSRERYRRYLRQYSDTPEIRVGGPTY
HWLRESLLVGEQIIAEAEKITTPVLLLQASEDRVVHNPAHDAFSQAMTLAGHPCEGGRPQ
VIQGARHEILFERDTLRAEALSAILRFFAQHQSSVGH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgctgttaggtcatcacatgaataattggttaacccgagaagagcaatttgctgctttt
attaatgggccattgttggatttctggcagcaacgagacgaacagacgtttatgggcgtc
gataatatccccattcgctatgtccgttttcgtgcgccgcatcatacccaagtcgtggtg
gtagtgccggggcgtatcgaaagttacgtcaaataccctgaagttgcttatgacctgttc
cagcagggctatgatgtgatagtgctggatcatcgcgggcaagggcgttctgggcgtatg
ctggatgatcataaccgtggtcacgtgattaagttcgatgactatattgaggattttgca
caactggtgcagatcgaaattaccggtagccattatcagcagcgttttgcgctggcccac
tcaatggggggcgcgattctgacgcgttttctagccagagagcctgatgtatttaatgcc
gttgcgttatgtgcgcccatgtttggtattcatttacccctgccgggctggttggcacgc
cgtattgttaactgggccgaagggcaccaaaagctacgggattattacgcgattggtact
gggcattggcggccactgccgtatttggtcaatatgctgactcacagccgcgagcgttat
cgccgctatttgcgccaatattcagacacaccagaaatccgcgtgggtggccccacttac
cattggctacgtgaaagtttgctggtgggggagcaaattattgctgaagcggagaaaatc
accactccggtattattgttacaggccagtgaggatcgggtggttcataacccagcccac
gatgctttttctcaggcaatgacattggcagggcacccctgtgaaggggggcgtcctcag
gtcattcaaggcgcacgccatgagatcctgtttgagcgggacacgctgcgtgccgaggcg
cttagcgccatattgcgctttttcgcgcaacatcaatcatcagtcggccattag

DBGET integrated database retrieval system