KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_0961Help
Entry
YPC_0961          CDS       T01874                                 

Gene name
ganB
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:yph00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
969122..971182
Genome map
AA seq 686 aa AA seqDB search
MSKFPPLSAKVSALLHGADYNPEQWENYPDIIDKDIAMMKQAKCNVMSVGIFSWVKLEPS
EGEYNFSWLDELIEKLYAAGIHIFLATPSGARPAWMSQKYPEVLRVGRDRVPALHGGRHN
HCMTSPVYRQKVRQINQKLAERYAHHPAVIGWHISNEYGGECHCHSCQQKFRLWLQDRYQ
TLDNLNEAWWSAFWSHTYSDWSQIESPAPQGEVSIHGLNLDWRRFNTAQVTEFCSEEAKP
LKAANPELPVTTNFMEYFYDYDYWKLAQVIDFISWDSYPMWHREKDETQLACYTAMYHDL
MRTLKQGRPFVLMESTPSATNWQPTSKLKKPGMHILSSLQAVAHGADAVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRVGREVSELGRILEAMSPVMGSKVDADVAIIFDWESRWAMDDA
EGPRNCGLEYEKTVAEHYRPFWERGIAVDIINADCDLSGYKLVIAPMLYMVREGFAERAT
RFVEQGGQFVATYWSGIVNESDLCHLGGFPGPLRPLLGIWSEEIDCLADGESNQVQGLAG
NKAGLQGPYQAIHLCDLIHLEGATAVARYRDDFYADRAAVTVNFVGEGKAWYVASRNDAA
FQRDFFMNIAEELNLARALDTQFPYGVTAHRRTDGESEFIVVENYSNDSKSLVLPAVYRD
MVDQQPVQGSLTLAPWGSRVLTRYLE
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagtttccgcccttaagcgcgaaagtttctgcgttattgcatggcgctgactat
aacccagagcaatgggaaaattatcctgacattattgataaagatattgccatgatgaaa
caggcaaaatgcaatgtcatgtcagtgggaatattcagttgggtaaaacttgagccaagt
gaaggagaatataatttctcttggttagatgaattaattgaaaaactttatgctgccggt
atccatatattcctggcgacgccaagtggcgcacgtccggcttggatgtcgcagaaatat
cctgaagttttacgtgtcgggcgtgatcgggtgcctgcgctgcatggtgggcgtcataac
cactgtatgacctcgccggtatatcgccagaaagtgcggcagataaaccagaagttagca
gagcgttacgcccatcatcctgcggttattggctggcacatctctaatgaatacggcggc
gaatgtcactgtcattcctgtcagcaaaaattccgcctctggcttcaggatcgttatcaa
acgctggataaccttaacgaagcctggtggagtgctttctggagccacacctacagcgat
tggtcgcaaattgagtctccagcaccgcaaggtgaagtttcaattcatggtctgaacctt
gactggcggcgttttaataccgctcaggttacggagttttgttctgaagaggctaagcca
ctaaaggcggcaaacccagagttgcctgttacgactaactttatggagtacttctacgat
tacgactactggaagttggcgcaggtgattgattttatctcctgggacagctacccgatg
tggcatcgtgagaaagatgaaacgcagcttgcctgttataccgcgatgtatcatgacctc
atgcgtaccctgaaacagggccgtccatttgtcttaatggaatcaacgccaagcgcgacc
aactggcaacctaccagtaagttgaagaagccggggatgcatatcctctcttctttacag
gctgtcgcgcacggtgcggatgcggtgcagtatttccaatggcgtaagagccgtggctcc
gttgagaagttccacggtgcggttgtcgaccatgttggccacattgatacccgtgttggg
cgggaggtgagcgaactgggtcgtatactcgaggccatgtcgccggtgatgggaagtaaa
gtagacgctgatgttgccatcatttttgattgggaaagtcgttgggctatggacgacgcc
gaaggcccacgtaattgtggcttggaatatgagaaaaccgttgccgagcattaccgtcca
ttctgggaacggggcattgcggtcgatatcattaacgctgactgcgatctgtcgggttac
aagctggtcattgcaccgatgctctatatggttcgcgaagggtttgctgaaagggcgacg
cgttttgtagagcaaggtgggcagtttgtcgcgacctactggagcggtattgtcaacgaa
tctgacctgtgtcatctcggtggcttccctggccctctgcggccgctgttgggtatctgg
tccgaagaaattgactgtctggccgatggcgagagcaatcaagtccaaggacttgcaggc
aataaagccggtctacaggggccttatcaggccatccatctctgcgatttgattcatctt
gaaggggcgacagccgtcgcgcgctatagagatgacttctatgctgaccgtgcggcggtg
accgtaaactttgttggcgaaggtaaagcctggtatgtcgcttcacgtaacgatgcggct
ttccagcgtgatttcttcatgaacattgccgaggagctaaacttggcacgtgcgctagac
acccagttcccttatggggttaccgctcaccgtcgtaccgatggtgagagtgaatttatc
gtggtagaaaactacagtaatgacagcaaatcgctggtgttacctgcggtataccgcgat
atggtcgaccagcagccggtacaaggtagcctgacgcttgccccatggggaagccgagtg
ctaactcgctatctcgaataa

DBGET integrated database retrieval system