KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_1163Help
Entry
YPC_1163          CDS       T01874                                 

Gene name
sdhD
Definition
succinate dehydrogenase, membrane subunit, binds cytochrome b556
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:yph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YPC_1163 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YPC_1163 (sdhD)
   00650 Butanoate metabolism
    YPC_1163 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    YPC_1163 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1155101..1155448
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVITLYVFYILGFVVIVPDITYEIWRGFFASHITKVF
TLLTLLSILAHAWIGLWQVLTDYIKPLAIRLVLQLVVVITLLVYLLYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttagggcgtaatggagtacacgattggttgttactgcgt
gcttctgcaatcgtcatcaccctgtatgtcttttatattctgggcttcgttgtgattgtc
ccagacatcacctatgaaatctggcgcggtttcttcgcgtcacacatcacaaaagtattt
acgctgctgacattgctgtcgattctagctcacgcttggatcggtctatggcaggtattg
acggactatataaagccactggcgatacgactggtgttacaactggtcgtcgtgattacg
ctgttggtttatttattgtatggaacaattgtggtgtggggagcttaa

DBGET integrated database retrieval system