KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_1190Help
Entry
YPC_1190          CDS       T01874                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:yph00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:yph00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1181394..1182290)
Genome map
AA seq 298 aa AA seqDB search
MLLGYPTPADYLHQAAYLGATVGRYANRIANAQITLDGETIQLVPNQGPNQLHGGPEGFH
AQRWQKVTQDDHQVTYKLDSPDGDQGFPGNLTVEVQYLLTEDNRLEIHYQAQVDKTCPVN
LTNHAYFNLDGEGHDARSHRLQLFADRYLPVDSAGIPTGGLADVENTGMDFRQPKTLAQD
FLQDRCQQRVKGYDHAYLLHRTCGALDSPAAHLWSSDNQVQMSMFTSAPALQLYSGNYLA
GTPARNGGTYASYAGVALESEFLPDSPNHPEWPQPDCWLKPGKTYRSTTVYHFIALPL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgctactgggctacccgacaccggctgattacctgcatcaagccgcttatctcggggcc
acggttggccgttatgccaaccggatagccaatgcgcaaatcaccttggatggcgaaaca
atccagttggtcccgaaccaaggccctaaccaattacacggtggcccggaaggtttccat
gcccagcgttggcagaaagtgacccaagatgaccaccaggttacctataaacttgattca
ccagatggcgatcaaggtttccccggtaatctgactgttgaagtacagtacctgctaacc
gaagataaccggctggaaattcattatcaggcacaggtggataaaacctgcccggttaac
ctgaccaatcatgcctatttcaaccttgacggcgaagggcatgatgcccgttcacatcgt
ttgcaactgtttgcagaccgttacctgcctgtcgacagtgcgggcatcccaaccggagga
ctcgctgatgtcgagaataccggtatggattttcgccaacctaaaacattggcgcaggat
tttctacaagatcgctgccagcaacgagttaaaggctatgaccacgcttatttgctgcac
cgcacctgtggggccttagactctccggcggcacacttgtggtcatccgataaccaggtg
caaatgagtatgttcacctcagcgcctgcgttgcagctttacagcggaaattatcttgct
ggcacacccgcacgcaacggcggcacctatgccagctatgcgggtgtggcactagaaagt
gaatttttgcctgatagccctaaccaccctgaatggccacagcccgattgttggctaaaa
ccggggaagacctatcgctcaacgacggtttatcactttattgcgttgcctttataa

DBGET integrated database retrieval system