KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_1319Help
Entry
YPC_1319          CDS       T01874                                 

Gene name
dapE
Definition
(GenBank) N-succinyl-diaminopimelate deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
yph00300  Lysine biosynthesis
yph01100  Metabolic pathways
yph01120  Microbial metabolism in diverse environments
yph01230  Biosynthesis of amino acids
Module
yph_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:yph00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    YPC_1319 (dapE)
Enzymes [BR:yph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     YPC_1319 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADV97956
Position
complement(1301943..1303070)
Genome map
AA seq 375 aa AA seqDB search
MICPVIELAQQLIKRPSLSPSDAGCQEIMIQRLAAIGFTIEPMNFGDTLNFWAWRGEGET
LAFAGHTDVVPTGDESHWHSPPFEPTIRDGMLYGRGAADMKGSLAAMIVAAERFVAAHPD
HKGRLAFMITSDEEAKATNGTVKVVEALMARHERLDYCLVGEPSSTDRVGDIVKNGRRGS
ITANLRIHGVQGHVAYPHLADNPVHRAMPALNELVATQWDEGNAFFPATSMQIANLQAGT
GSNNVIPGEFYVQFNFRFSTELTDSLIKQRVAALLDRHQLDYTLEWVLSGQPFLTAKGAL
VDAVVNAVKHYTEITPQLLTTGGTSDGRFIALMGAQVVELGPVNATIHKVNECVSAADLQ
LLSRMYQKIMEQLIA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtccggtaatcgaattggcccaacagttaattaaacgcccatcgctcagccct
tcagatgcgggttgccaagagatcatgatccagcgcctagccgccatcggctttaccatc
gaacccatgaattttggtgatacgcttaatttttgggcatggcgtggcgaaggcgaaacg
ctggcatttgctggtcacacggatgtggtgcctaccggtgacgagagccactggcacagc
ccaccgtttgaacccaccatccgtgacggcatgttgtatggccgaggtgccgcagacatg
aaaggctcactggcagcaatgatcgtagcagccgagcgttttgtcgccgcgcaccctgac
cacaaaggccgcctggcctttatgataacctccgatgaagaagccaaagccaccaacggt
acagtaaaagtggttgaagccctgatggcacgccacgagcggctggattattgtctggtg
ggcgaaccatccagtactgaccgggttggcgatatcgtgaaaaatggccgccgtggctcc
atcaccgctaacttgcgtattcatggagtgcaagggcacgtggcgtatcctcatctggcg
gataatcccgttcatcgtgctatgccagcgctgaatgaattggttgccacccaatgggat
gaaggcaatgcgtttttccctgccaccagtatgcaaattgccaatttacaggccggtacg
ggcagcaataatgttattcccggtgaattttatgtgcagtttaacttccgtttcagtact
gaactgactgacagcctgatcaagcaacgggtagccgcattgctggatcgacatcagctt
gattacaccctggaatgggtattgtctggtcaacctttcctgaccgccaaaggggcgttg
gtggatgccgtggttaatgccgttaagcattacactgaaatcacaccgcaactgttaacc
accggggggacgtcagatggccgctttattgcgttaatgggggcgcaagtggttgagttg
gggccagttaatgccaccattcataaagttaatgaatgtgttagcgcggctgatttacaa
ttgctcagccgtatgtaccagaaaatcatggaacaactgatcgcatga

DBGET integrated database retrieval system