KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_1418Help
Entry
YPC_1418          CDS       T01874                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
yph00010  Glycolysis / Gluconeogenesis
yph00052  Galactose metabolism
yph00500  Starch and sucrose metabolism
yph00520  Amino sugar and nucleotide sugar metabolism
yph00521  Streptomycin biosynthesis
yph01100  Metabolic pathways
yph01110  Biosynthesis of secondary metabolites
yph01120  Microbial metabolism in diverse environments
yph01130  Biosynthesis of antibiotics
yph01200  Carbon metabolism
Module
yph_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
yph_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:yph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPC_1418 (glk)
   00052 Galactose metabolism
    YPC_1418 (glk)
   00500 Starch and sucrose metabolism
    YPC_1418 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    YPC_1418 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    YPC_1418 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    YPC_1418 (glk)
Enzymes [BR:yph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     YPC_1418 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C ROK
Motif
Other DBs
NCBI-ProteinID: ADV98045
Position
1389715..1390686
Genome map
AA seq 323 aa AA seqDB search
MTTYALVGDVGGTNARLALCAVATGEILQAKTYSGLEYESLEDVIKQYLSEHQAKVTDAC
IAIACPITGDWVAMTNHTWAFSIAAMQQNLGLDHLEVINDFTAVSMAIPVLPAQDVLQFG
GTQPQPGKPVAVYGAGTGLGVAHLVNVDRRWISLAGEGGHVDFAPNSEEEDQILAVLRQE
LGHVSAERVLSGPGLVNLYRAIVISDARLPEKLAPKDITARALADSCTDCRRALSLFCVI
MGRFGGNLALNLSTFGGVYIAGGIVPRFMEFFKASGFRAAFEDKGRFKDFLQDIPVYMIT
HPQPGLLGAGAYLRQKLGYELSS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacgacttatgccctggtgggtgacgttggcggtacgaatgcccggttggcgctttgc
gctgttgcaacgggcgagatattgcaagcaaagacatattcagggttggaatatgaaagt
ttagaggatgtaatcaaacaatatctatcagagcatcaagccaaggtcaccgatgcttgt
atcgcgattgcctgcccgattaccggggattgggtcgcaatgaccaatcatacttgggca
ttttctattgccgccatgcaacagaatctgggtctggaccatttggaagtgatcaatgac
ttcaccgcagtctccatggctatccccgtgttacctgcccaagatgttctgcaatttggt
ggcacacagccacagcctggcaaaccggtggcagtgtatggcgcaggtactgggctgggg
gtagcacatttagtgaatgttgatcgccgttggattagtttagcgggagagggcgggcat
gttgatttcgcgcctaatagtgaagaagaagaccagattctggccgtattgcgccaggag
ttggggcatgtttccgctgagcgggtgctatctgggccgggcttagtcaatttatatcgg
gcaattgtgatttctgatgcgcgcctaccagagaaactggcaccgaaagatattaccgca
cgggcgctggcggatagctgtaccgattgtcgccgggcattatcactattttgcgtaatt
atgggccgctttgggggcaatttagcccttaacctcagtacgtttggtggcgtttatatt
gcggggggcatcgtgccgcgctttatggagttctttaaagcctctggttttcgcgctgcg
tttgaagataaaggccgttttaaagatttcttacaagatattccggtgtatatgattact
catccacaacccggtttactgggggctggtgcctatttacgccaaaaattggggtatgag
ttgtcaagctaa

DBGET integrated database retrieval system