KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_1498Help
Entry
YPC_1498          CDS       T01874                                 

Definition
putative fatty oxidation complex alpha subunit, enoyl-CoA hydratase (EC:4.2.1.17 1.1.1.35 5.1.2.3 5.3.3.8)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:yph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YPC_1498
   01212 Fatty acid metabolism
    YPC_1498
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YPC_1498
   00650 Butanoate metabolism
    YPC_1498
  Lipid metabolism
   00071 Fatty acid degradation
    YPC_1498
   01040 Biosynthesis of unsaturated fatty acids
    YPC_1498
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YPC_1498
   00310 Lysine degradation
    YPC_1498
   00380 Tryptophan metabolism
    YPC_1498
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YPC_1498
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YPC_1498
   00281 Geraniol degradation
    YPC_1498
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    YPC_1498
Enzymes [BR:yph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     YPC_1498
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YPC_1498
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     YPC_1498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1467682..1470006
Genome map
AA seq 774 aa AA seqDB search
MSKENIVTRENTAVSENAVSEPTVNNDVGASATNSVTHPAFTLNVRPDNIGIITIDVVGD
KVNTLKAEFADQIATILQQAHALPKLQGLVIVSGKPDSFIAGADITMIAACRTAHDARVL
AQKGQSILAQIAAFPVPVVAAIHGACLGGGLELALACHSRICSLDDKTVLGLPEVQLGLL
PGSGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRAKAGW
LNRRALPWQERLLSGPLGKALLFRIVRKKTLAKTRGHYPAAERIIDVVRKGLDQGGPSGY
EAEARAFGELAMSPQSVALRSLFFATTSLKKETGSAATARAIHRVGVLGGGLMGGGIANV
TATRAGLPVRIKDINPQGINQALKYTWDALGKRVRSKRMRPTEQQRQMMLISGSTDYRGF
ERVDIVVEAVFEDLSLKQQMVADIERFGAAHTIFASNTSSLPISQIAALAQRPEQVIGLH
YFSPVDKMPLVEVIPHEKTSEETIATTVALARKQGKTAIVVADRAGFYVNRILAPYINEA
ARCLLDGEPIESVDNALVDFGFPVGPMMLLDEVGIDVATKIMPILVEQLGPRFAAPPSFD
VILKDGRKGRKNGRGFYLYSNPTKNSSPTKNGNSPAKRNSFKWRKNKVKPVDASIYTLLG
VTPKAHLGAGVITQRCTMLMLNEAVRCLDESIIRNPRDGDIGAVFGIGFPPFLGGPFRYL
DSLGADKVVQALRLLVQQYGERFEPCQRLVTMAEQQQQFYPVDANIDEVTDVAS
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggaaaatatcgttacccgtgaaaatacagctgtcagtgaaaatgcagtcagt
gaacctacagtgaataatgatgtgggcgcatcggccacgaattcagttacccatcccgca
tttaccctcaacgtaaggccggacaatattggcattatcaccattgatgttgttggtgac
aaagtgaataccctaaaggctgaatttgctgatcaaattgccactatattgcaacaagcg
cacgctctaccaaaattacagggactcgtcattgtttctggcaaaccagactccttcatt
gccggtgcggatatcacgatgatcgcggcttgtcgtaccgctcacgacgcccgcgtatta
gcacaaaaaggccaatcaattttggcgcaaattgccgctttccctgtgccggttgtggct
gcgattcatggcgcttgtctggggggagggctagagctggcgctggcttgccatagccgc
atatgttctctggatgataaaaccgttctcgggctaccggaggtgcaactggggttactg
cctggctccggcgggacgcaacgtctgccgcgtttagtgggggtcagtaaagcactggat
atgatattgaccggtaaacagatacggccccgtcaggcactaaaaatggggctggtggat
gatgttgtgccacgcgatatcttattggatgtggcgattcagcgcgcgaaagcggggtgg
cttaatcgacgagcattaccatggcaggagcgtttactcagtgggccgttgggtaaagct
ttattattccgtattgtccgtaaaaaaacgctagctaaaacgcgggggcactacccggcg
gctgaacgtattattgatgtggtgcgtaaaggattagatcagggcgggccaagtggttat
gaggcagaagccagagcatttggcgagttggcgatgtcgcctcagtcagtcgcattacgc
agcctgttttttgccacgacgtcactgaaaaaagagaccggaagtgcagccacagcgcgt
gcaattcatcgggtcggcgtattgggcggtggcttgatgggcggaggtattgccaacgta
acggctacccgagcgggcttgccagtgcgtatcaaagatatcaatccgcaaggaattaat
caggcgctgaaatatacctgggacgcattgggtaaacgggttcgtagtaagcggatgcgc
ccaactgaacagcagcggcagatgatgttgatctctggtagtacggattaccgtggtttt
gaacgtgtcgatattgtggtggaagcggtatttgaggatttatcactgaagcagcaaatg
gttgctgacatcgaacgatttggtgccgcccatactatttttgcctccaatacatcatca
ctccccatcagccagattgctgctttggcgcaacggccagagcaggttattggcctgcac
tattttagtccagtagataaaatgccactggttgaagtcatcccccatgaaaaaaccagt
gaagagaccatcgctaccaccgttgctttagcccggaaacagggtaaaacagccattgtg
gtggctgatcgcgctgggttctatgtaaaccgcattttggcaccttatattaatgaagct
gcccgttgcctgctcgacggagagcctatcgaatcagttgataacgcgttggtcgatttt
ggtttccccgtaggccccatgatgctgcttgatgaggttgggattgatgttgcgaccaaa
ataatgccgattctggtcgagcaattagggccgcgttttgctgcgcccccgtcatttgac
gttattttgaaggatggacgtaaagggcgcaaaaatggccgtggcttttatttatattca
aaccccacaaaaaattcatctccaacaaaaaatgggaattctccggcgaagcgtaatagc
tttaagtggagaaaaaacaaagtaaaaccagtcgatgccagtatctataccttgttgggg
gtgacacctaaagcccatcttggtgcaggcgtgattactcaacgttgtaccatgctgatg
ttgaacgaagcggtacgctgtctggatgaatcgatcattcgtaacccgcgcgatggtgat
attggtgcagtgtttgggatcggttttccgcctttcctcggtggtccgttccgctatttg
gatagcctgggagccgataaggtggtacaagcactcagattattggtacagcaatacggt
gagcgtttcgaaccttgccagcggttggtaacaatggctgaacaacaacaacaattctat
cccgtggacgccaatatagatgaggtgacggacgtggcaagctga

DBGET integrated database retrieval system