KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_1802Help
Entry
YPC_1802          CDS       T01874                                 

Gene name
adhE
Definition
NADP-dependent alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:yph00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    YPC_1802 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPC_1802 (adhE)
   00620 Pyruvate metabolism
    YPC_1802 (adhE)
   00650 Butanoate metabolism
    YPC_1802 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    YPC_1802 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    YPC_1802 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    YPC_1802 (adhE)
   00626 Naphthalene degradation
    YPC_1802 (adhE)
Enzymes [BR:yph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     YPC_1802 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     YPC_1802 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1767740..1770415)
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNELVARVKKAQREYANFSQEQVDKIFRAAALAAADARIPLAKLAVTESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILCEDKTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKDATNKAADIVLQAAIAAGAPADIIGWIDAPTVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRVVASILMSKTF
DNGVICASEQSIIVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGGLNAAIVGQP
ATKIAEMAGIKVPSNTKILIGEVKVVDESEPFAHEKLSPTLAMYRAKNFEEAVEKAEKLV
EMGGIGHTSCLYTDQDNQTARVKYFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVATDGAK
RAFIVTDRYLFNNGYADQVTSVLKSHGIETEVFFEVEAAPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKLVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKEFLPASYNEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANAMLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAQKIQKLLAWLDEIKAELGIPASIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLISELKQILMDTYYGREYVEEFDREEEVAAATAPKAEKKTKK
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacgaatgtcgctgaacttaacgagctagtagcacgcgtcaagaaagcccag
cgcgagtatgccaacttttcgcaagagcaagttgataaaatcttccgtgctgcagcatta
gccgctgcggatgcccgtattccactagccaaactggctgtaacagagtctggcatgggt
attgttgaagacaaagtgatcaaaaaccactttgcttctgaatatatttacaatgcttat
aaagatgaaaaaacctgtggtattttgtgtgaagataagaccttcgggacgatcactatc
gcagaacctattggtctaatctgcggtatcgtaccaaccactaaccctacgtctaccgct
atttttaaagcactgattagcttgaagacacgtaacggtattatcttctccccacatcca
cgcgctaaagacgcaaccaataaagctgcggatatcgtgcttcaagccgctatcgcagca
ggtgcgccagcggatattattggttggattgatgctccaacagttgaattatctaatcaa
ctgatgcatcacccagacattaatcttattctggcaaccggtgggccaggtatggttaaa
gcggcctatagctctggtaaaccagccatcggcgtaggtgcgggtaatacgccagtcgtc
gttgacgaaactgcagatattaaacgtgttgtcgcatctattctgatgtctaaaaccttt
gataacggtgttatctgcgcgtcagagcagtccatcatcgttgttgactcggtttacgat
gcggttcgcgagcgttttgcttctcatggtggctacctgttacaaggtaaagaattgaaa
gccgttcaggatattatcctgaaaaatggcggtctaaacgcagccatcgtgggccagcca
gcaactaagatcgctgagatggctggcattaaagtgccaagtaataccaagatacttatc
ggtgaagtcaaagttgtcgatgaatcagagccatttgctcatgaaaaactgtcgcctaca
ctggcaatgtatcgtgctaaaaactttgaagaagcggttgaaaaagcagagaaactggtg
gagatgggcggtatcggtcatacctcttgtctgtacaccgaccaagataaccagactgca
cgcgttaaatatttcggcgataaaatgaagaccgcccgaattctaatcaacacccctgcc
tctcaaggtggtatcggtgacttgtataacttcaagctggcaccgtctctgacgctgggt
tgtggttcttggggtggtaactccatctctgaaaacgtcggtccgaaacacttgatcaac
aagaaaactgtggctaagcgagcagaaaacatgttgtggcataaactaccgaaatctatt
tacttccgtcgcggctctctgcctatagcgttggaagaagtggcaactgacggtgcaaaa
cgtgccttcatcgtgactgaccgctacttgttcaacaacggttatgcagaccaagtcacc
agcgtactgaaatctcacggtattgaaactgaagttttcttcgaagtagaagctgcccct
accctgagtatcgtgcgtaaaggtgcagagcagatgaactccttcaagccagacgttatt
attgctctgggtggtggttcaccgatggatgctgcaaaaatcatgtgggtaatgtacgaa
catcctgaaacgcatttcgaagaactggcattgcgttttatggatatccgtaaacgcatt
tataagttcccgaaaatgggtgtaaaagcgaaattggtcgctattacaaccacatcaggt
accggttcagaagtcaccccgtttgccgtggttactgatgacgcaacaggccagaaatat
ccattggcagactatgcattgacaccagatatggccattgttgatgccaaccttgttatg
aatatgcctaagtctctgtgtgccttcggtggtctggatgcagtaacgcacgcactggaa
gcctatgtgtctgtactggctaatgaatactctgacggccaggcgctgcaagcactgaag
ctgttgaaagaattcttgccagccagctacaacgaaggggctaaaaacccagttgctcgc
gaacgtgtacataatgcagcaacaattgccggtatcgcctttgctaacgccttcttgggt
gtctgtcactctatggcccacaaactgggttctgagttccatatcccacacggcttggca
aatgctatgttgatttctaacgttattcgctacaacgcgaatgacaacccaacaaaacag
actgccttcagccaatatgaccgcccacaagcgcgtcgtcgttatgcagaaattgcagat
catttggggctgagtgcaccgggcgaccgtactgcacaaaaaatccagaaactgctggct
tggttagatgaaatcaaagctgaactgggtatcccggcatcgattcgcgaagcgggtgtt
caggaagctgacttcttagctaaagtagacaaattgtctgaagatgcatttgatgaccag
tgcacaggtgctaacccacgctacccactgatctcagagctgaaacagatccttatggat
acttattacggtcgcgaatatgttgaagagtttgaccgcgaagaagaagtcgcggcagct
actgcgcctaaagctgagaaaaagaccaaaaagtaa

DBGET integrated database retrieval system