KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_1833Help
Entry
YPC_1833          CDS       T01874                                 

Gene name
trpC
Definition
(GenBank) tryptophan biosynthesis protein TrpCF (EC:4.1.1.48 5.3.1.24)
  KO
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:yph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YPC_1833 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YPC_1833 (trpC)
Enzymes [BR:yph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     YPC_1833 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     YPC_1833 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1794713..1796140)
Genome map
AA seq 475 aa AA seqDB search
MQETGGYKTEGYNVGSDKVDSDKTKTVLHQIVHDKEIWVAARKLQQPLTRFQNEITQSQR
DFYHALQGDKTVFILECKKASPSKGVISDNFNPAEIAGVYKHYASAISVLTDEKYFQGSF
DFLPQVSAAVTQPVLCKDFIIDAYQIQLARFYHADAILLMLSVLDDEAYRQLAAVAHSLN
MGVLTEASNAEELERAITLGAKVVGINNRDLRDLSIDLNRTRELAPRLPEGVTIISESGI
SHYRQVRELSQFANGFLIGSALMSEPDLNAAVRRVLLGENKVCGLTRAQDAATAYHAGAV
YGGLIFVDSSPRYVDIASARTVISGAPLKYVGVFRHAEIETVRQTAEQLSLAAVQLHGHE
DQQYINQLRKVLPADCQIWKALSVGDTMPERNLQQVERYVLDHGTGGTGQRFDWSLLADQ
ALDNVLLAGGLGPDNCDVAAQLGCAGLDVNSGVESAPGIKDPQRIAAVFQALRVY
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaactgggggttacaaaaccgagggttataacgttggcagtgacaaagttgac
agtgataaaaccaaaaccgtgctccaccaaatcgtacacgataaagaaatttgggttgcc
gcgcggaaactgcaacagcctctaacccgcttccaaaacgaaatcacccagagtcagcgc
gatttttatcacgcgctacaaggcgataaaacggtctttattttggaatgcaaaaaagcc
tcaccttctaaaggggttatcagtgacaactttaacccggcggagattgccggtgtttat
aagcactatgcgtcggctatctcagtattaacggatgagaaatatttccagggcagtttt
gatttcttgccacaagtcagtgccgccgtcactcagccggtattgtgtaaagattttatt
attgatgcttatcagattcagctagcgcggttttaccacgctgacgccattttactgatg
ctgtcggtcttggacgatgaggcttaccgccaattggccgccgtcgcacacagcctgaac
atgggggtgttgaccgaagccagtaacgccgaagaattggagcgtgctattaccttgggt
gccaaagttgttggcatcaataaccgcgacctgcgtgacctgtctatcgatctgaatcgc
acccgtgaattggcaccacgcctaccagaaggtgtcacaataatcagtgaatctggcatt
agtcattatcgtcaggtccgtgaattgagccaatttgccaacggtttcctgattggcagt
gccctgatgtccgaacccgatctcaacgcggccgtccgccgggtgttactgggcgaaaat
aaagtttgcggcctgacacgcgcacaagatgccgccacggcttaccacgcaggtgcggtg
tacggcgggttgatttttgtcgacagttcaccccggtatgtggatatcgccagcgcccgt
acggttatcagtggtgcgccgctaaagtatgtcggtgtttttcgtcatgctgaaatagaa
actgtacggcaaacggctgaacaactctcactggcagcagtgcaattgcatgggcatgaa
gatcaacagtatatcaatcaactgcgcaaagtattacctgcggattgccagatttggaag
gcactgagtgtcggtgacacgatgccggaacgcaacttacagcaagttgaacgctacgta
ttggatcacggtacgggtggcacagggcaacgtttcgactggtcattattggcagatcaa
gcactagataatgtcttgctggcaggcggcttggggccagataactgtgatgtggcagcc
caactaggctgtgccgggctggatgtcaattccggcgtagaaagcgcccctggcatcaaa
gacccccaacggatcgccgctgtattccaggcattacgcgtgtactga

DBGET integrated database retrieval system