KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_1999Help
Entry
YPC_1999          CDS       T01874                                 

Gene name
tyrS
Definition
tyrosyl-tRNA synthetase (EC:6.1.1.1)
Orthology
K01866  
tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:yph00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1966166..1967440)
Genome map
AA seq 424 aa AA seqDB search
MTSSNLIKQLQERGLVAQVTDEDALAERLAQGPISLYCGFDPTADSLHLGHLVPLLCLKR
FQLAGHRPVALVGGATGMIGDPSFKASERKLNTEDTVNEWVEKIRHQVSPFLDFDCGENS
AIAANNYDWFGGMNVLTFLRDIGKHFSVNQMINKEAVKQRLNRDDSGISFTEFSYNLLQA
YDFACLNKNHGVALQIGGSDQWGNITSGIDLTRRLHQQQVYGLTVPLITKADGTKFGKTE
GGAVWLDPKKTSPYKFYQFWINTADADVYRFLKFFTFMSLEEINALEEEDKNSGKAPRAQ
YVLAENVTGMVHGPEGLAAAKRITDSLFSGDLHDMTEADFAQLAQDGMPTVELNRDADLQ
QALVNAELVPSRGQARTMIGSNAVAINGEKQADPEYVFTDADRLFGRYTLLRRGKKHYCL
ISWL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgactagcagcaacctgattaaacaattgcaagagcggggcctcgttgcccaggttacg
gatgaagacgcgttagcagagagactggcgcaagggccaatttcactgtattgcggtttc
gatcctaccgcagacagcttgcacttgggtcatctggttcccttgttatgtctgaagcgt
tttcagttagcgggtcaccgcccggtggcgttggtcgggggcgctaccggtatgattggc
gacccaagcttcaaagccagtgagcgtaaattgaataccgaagatacagtgaatgagtgg
gtcgagaaaatccgccaccaggtctcgccattcctggattttgattgcggtgaaaacagt
gctattgcagccaataactatgattggtttggtggcatgaatgtgctcactttcctgcgt
gatattggcaaacacttctcagttaatcagatgattaataaagaagccgtcaagcagcgc
ttgaaccgtgatgacagcggtatctcgtttactgagttctcatacaatttattgcaggcg
tatgatttcgcttgtttaaacaaaaatcacggtgttgcgctgcaaatcggtggttctgac
cagtgggggaatattacctccggtattgacctgacccgtcgcctccatcaacagcaggtt
tatggcctgacggtaccgctgatcaccaaagccgatggcactaaattcggtaaaaccgaa
gggggtgcagtctggctggatccaaagaaaaccagtccttacaaattctaccaattctgg
attaatactgccgatgctgatgtgtatcgcttcctgaaattctttactttcatgagtttg
gaagagattaacgcactggaagaagaagataaaaacagtggtaaagcaccgcgcgcgcaa
tatgttttggcggaaaatgtcacgggtatggtgcatggtccagaaggcttggcagcggcg
aaacgtatcactgacagcctgttttcgggtgatttgcatgatatgaccgaagcagacttt
gcccagttggcacaagatggtatgccgacggttgagctgaaccgtgatgctgatttacag
caagcgctggttaatgctgagctggttccttcccgtggtcaggcgcgcacgatgattggt
tctaatgccgtggccatcaatggtgagaaacaggctgatccagaatacgtctttacggat
gcggatcgcctgtttggccgttatactttgttgcgccgtggcaaaaaacactattgcctg
attagttggctgtaa

DBGET integrated database retrieval system