KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_1999Help
Entry
YPC_1999          CDS       T01874                                 

Gene name
tyrS
Definition
tyrosyl-tRNA synthetase (EC:6.1.1.1)
Orthology
K01866  
tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:yph00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    YPC_1999 (tyrS)
Enzymes [BR:yph01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     YPC_1999 (tyrS)
Amino acid related enzymes [BR:yph01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   YPC_1999 (tyrS)
Transfer RNA biogenesis [BR:yph03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    YPC_1999 (tyrS)
 Prokaryotic Type
    YPC_1999 (tyrS)
Mitochondrial biogenesis [BR:yph03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    YPC_1999 (tyrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1966166..1967440)
Genome map
AA seq 424 aa AA seqDB search
MTSSNLIKQLQERGLVAQVTDEDALAERLAQGPISLYCGFDPTADSLHLGHLVPLLCLKR
FQLAGHRPVALVGGATGMIGDPSFKASERKLNTEDTVNEWVEKIRHQVSPFLDFDCGENS
AIAANNYDWFGGMNVLTFLRDIGKHFSVNQMINKEAVKQRLNRDDSGISFTEFSYNLLQA
YDFACLNKNHGVALQIGGSDQWGNITSGIDLTRRLHQQQVYGLTVPLITKADGTKFGKTE
GGAVWLDPKKTSPYKFYQFWINTADADVYRFLKFFTFMSLEEINALEEEDKNSGKAPRAQ
YVLAENVTGMVHGPEGLAAAKRITDSLFSGDLHDMTEADFAQLAQDGMPTVELNRDADLQ
QALVNAELVPSRGQARTMIGSNAVAINGEKQADPEYVFTDADRLFGRYTLLRRGKKHYCL
ISWL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgactagcagcaacctgattaaacaattgcaagagcggggcctcgttgcccaggttacg
gatgaagacgcgttagcagagagactggcgcaagggccaatttcactgtattgcggtttc
gatcctaccgcagacagcttgcacttgggtcatctggttcccttgttatgtctgaagcgt
tttcagttagcgggtcaccgcccggtggcgttggtcgggggcgctaccggtatgattggc
gacccaagcttcaaagccagtgagcgtaaattgaataccgaagatacagtgaatgagtgg
gtcgagaaaatccgccaccaggtctcgccattcctggattttgattgcggtgaaaacagt
gctattgcagccaataactatgattggtttggtggcatgaatgtgctcactttcctgcgt
gatattggcaaacacttctcagttaatcagatgattaataaagaagccgtcaagcagcgc
ttgaaccgtgatgacagcggtatctcgtttactgagttctcatacaatttattgcaggcg
tatgatttcgcttgtttaaacaaaaatcacggtgttgcgctgcaaatcggtggttctgac
cagtgggggaatattacctccggtattgacctgacccgtcgcctccatcaacagcaggtt
tatggcctgacggtaccgctgatcaccaaagccgatggcactaaattcggtaaaaccgaa
gggggtgcagtctggctggatccaaagaaaaccagtccttacaaattctaccaattctgg
attaatactgccgatgctgatgtgtatcgcttcctgaaattctttactttcatgagtttg
gaagagattaacgcactggaagaagaagataaaaacagtggtaaagcaccgcgcgcgcaa
tatgttttggcggaaaatgtcacgggtatggtgcatggtccagaaggcttggcagcggcg
aaacgtatcactgacagcctgttttcgggtgatttgcatgatatgaccgaagcagacttt
gcccagttggcacaagatggtatgccgacggttgagctgaaccgtgatgctgatttacag
caagcgctggttaatgctgagctggttccttcccgtggtcaggcgcgcacgatgattggt
tctaatgccgtggccatcaatggtgagaaacaggctgatccagaatacgtctttacggat
gcggatcgcctgtttggccgttatactttgttgcgccgtggcaaaaaacactattgcctg
attagttggctgtaa

DBGET integrated database retrieval system