KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_2059Help
Entry
YPC_2059          CDS       T01874                                 

Gene name
btuE
Definition
putative glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:yph00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:yph00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2026760..2027314)
Genome map
AA seq 184 aa AA seqDB search
MSHPIYAISVQTIDHQLVKLAKYKGSVLLVVNVASQCGLTQQYEGLESLYKTYQKQGFEV
LGFPSNEFAGQEPGSDEEIHAFCRGTFGVDFPMFSKIEVNGPHRHPLYQHLVTAKPVAVK
PEGSEFYQRLASKGREPKQPGDILWNFEKFLISRDGTVLARFAPDMAPEAPILINAINQA
LASH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacccaatttacgccatttcagtgcaaacgattgatcaccagctggttaagttg
gcgaagtataaaggttccgttttattagtggtgaatgtggcttcgcaatgtggtttgact
cagcaatatgaaggattagaaagcctctataaaacctatcagaagcaaggttttgaggtt
ttaggtttcccgagtaatgagtttgcaggacaagagcctggcagtgatgaggaaattcat
gctttctgccgtggtacttttggtgtcgacttccccatgttcagtaaaattgaagtcaat
ggtccacatcggcatcctctatatcagcacttggttactgctaagcctgttgcagtgaaa
ccggaaggaagtgaattttatcaacgcctggcgagtaaaggccgtgagccaaaacagccg
ggtgatatcctatggaattttgagaaattcttgattagccgtgatggcactgtcttggcg
cgttttgctccagatatggcaccagaagcacctattttaatcaatgccatcaatcaggca
ctggctagccactaa

DBGET integrated database retrieval system