KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_2214Help
Entry
YPC_2214          CDS       T01874                                 

Definition
putative phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Brite
Enzymes [BR:yph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     YPC_2214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2169375..2169887)
Genome map
AA seq 170 aa AA seqDB search
MATIKRIASGSACAVAVIIAIVISAGNVRTSERGLELIGNAESCRRDPYACPAGVLTDGI
GNTHGVKAGVIKTDTQIAEDWEKNILDAERCVIRYANGNKLPPSAFDAATSISFNAGCSL
MQKSTMFKYFRAGNVTAACEQFPRWIYGGGKKLPGLVTRREKEKALCLES
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaataaaacgcattgcctccgggtctgcttgtgctgttgcagtcatcatcgcg
attgttatttcggcgggcaacgtaagaactagcgaacgaggacttgagctgatcggcaat
gctgaatcatgccgccgcgacccatacgcttgtccggctggagtactgactgatggcatt
ggcaacactcatggcgtcaaggctggagttattaagaccgacactcagatagccgaagat
tgggaaaagaacattcttgatgctgaacgctgcgtcattcgctatgcaaatggcaataaa
ttaccgcccagcgcttttgatgccgctacgtcaatcagctttaacgccggttgctcattg
atgcagaaatccacaatgttcaagtattttcgcgctggtaacgtgacagcggcctgtgaa
cagttcccgcgctggatatatggtggcggtaaaaaattgccggggctggtgactcgtcgc
gagaaggagaaggcgctatgcctggaaagttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system