KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_2258Help
Entry
YPC_2258          CDS       T01874                                 

Gene name
ruvA
Definition
component of RuvABC resolvasome, regulatory subunit (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:yph00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YPC_2258 (ruvA)
Enzymes [BR:yph01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YPC_2258 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2204903..2205517)
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGIILEKQPPLVLLETNGVGYEVQLPMTCFYELPELGQEAIIFTQFVVREDAQLL
YGFNNKQERALFRELIKVNGVGPKLALAILSGMSAQQFVGAVEREDITTLVKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNNTGDISLPTASPQTSDADIEAEAASALVALGYKPQEASR
LVSKIAKPGADCETLIRDALRAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgataggccgtctcagaggtatcattctggaaaaacagccaccgctggtgctgctggaa
acaaacggtgttggctatgaagtccaattaccaatgacctgcttctatgagttacccgag
ttggggcaggaagccattatcttcacccagtttgtggtacgcgaagatgcgcagttactg
tatggtttcaataataagcaggagcgggcgctgttccgtgaattgatcaaagttaacggc
gtcgggccaaaactggctttagccattctctccgggatgtctgcacagcaatttgttggc
gcagtcgaacgtgaagatattacaacgctggtaaaactgccgggtgtcggtaaaaagacc
gccgagcggttagtggtcgaaatgaaagatcgctttaaaggccttaacggcgatctgttt
aataataccggtgatatctcgttaccaacggcttcgccacaaacctcggatgctgatatc
gaagcggaagccgcttctgcactggtcgcgctgggttataaaccacaagaggccagccgt
ttagtgagtaaaattgccaagccgggtgccgattgtgaaacactgatccgtgatgctctc
cgtgcggcgttataa

DBGET integrated database retrieval system