KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_3244Help
Entry
YPC_3244          CDS       T01874                                 

Gene name
asnB
Definition
(GenBank) asparagine synthetase B
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
yph00250  Alanine, aspartate and glutamate metabolism
yph01100  Metabolic pathways
yph01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yph00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YPC_3244 (asnB)
Enzymes [BR:yph01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     YPC_3244 (asnB)
Peptidases [BR:yph01002]
 Cysteine Peptidases
  Family C44
   YPC_3244 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: ADV99743
Position
3124409..3126073
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLELKTDPIELRKKALEMSRLMRHRGPDWSGVWANDKAILAHERLSIVDVNTGA
QPLYNAAHTHILAVNGEIYNHQALRQQYSDRYAFQTGSDCEVILALYQEKGPAFLDDLQG
MFAFVLYDTEKDAYLIGRDHLGIIPLYMGHDEHGNMFVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIREYYHRDWFDYDHVKDNVTDKIQLANALEDAVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAARRVEDNERSEAWWPQLHSFAVGLIGSPDLRAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKNFLDVAMRINPQD
KMCGNGKMEKHILRECFESYLPHSVAWRQKEQFSDGVGYSWIDTLKEKAAEQVTDQQMET
AHFRFPYNTPGSKEGYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDESFKNMDD
PSGRAVGVHQDAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctattttcggggtcttagagcttaaaaccgaccctattgaattacgcaagaaa
gcgctagaaatgtcacgtttgatgcgtcaccgtggcccagactggtctggtgtctgggcg
aatgataaagccatcctcgcccatgagcgcttatctattgttgacgtcaataccggtgcc
cagccgctgtataatgccgcccacacacatatcttggccgtgaatggtgaaatttataat
catcaagcattacgtcagcaatatagcgaccgttacgccttccaaacgggttcagactgt
gaagttattctggcgttgtatcaagaaaaagggcccgcgttcctcgatgatctgcaaggg
atgtttgccttcgtcctatacgataccgagaaagacgcctacctgatcggccgtgaccat
ttaggtattatcccgctgtatatggggcacgacgaacacggcaatatgtttgtagcttcg
gaaatgaaagccttggtacccgtttgccgcaccataaaagaattccctgctggcagctat
ttgtggagtcaggatggcgagatccgcgaatactatcatcgcgattggtttgattacgac
cacgtcaaagacaacgtaaccgacaaaatccaacttgccaacgcattggaagatgcggtt
aaaagccatctgatgtccgatgtcccttatggggtattgctgtctggtggcctggattca
tccgttatctctgctatcaccaaaaaatttgccgcccgccgtgtagaagataatgaacgc
agcgaagcctggtggccacaactgcactccttcgccgtcggtttgattggctcacccgat
ttacgcgcagcacaagaagtcgctaaccacttgggcacggtacaccatgaaattcatttc
accgtgcaggaagggctggatgccatccgcgatgtgatttatcacatcgaaacctatgat
gtgacgactatccgcgcgtcaacgccgatgtacctgatgtcacgtaaaatcaaagccatg
ggcatcaaaatggtgctatctggtgagggttctgacgaagtcttcggtgggtatctctat
ttccacaaagcgcccaacgccaaagaattacatgaagaaaccgtgcgtaaactgttagct
ctccatatgtatgactgcgcccgtgccaacaaagcgatgtcagcttggggcgttgaagct
cgtgtgcccttcctggataaaaacttccttgatgtcgccatgcgtatcaatccacaggat
aaaatgtgcggcaatggcaaaatggagaaacatatcctgcgagaatgtttcgaatcttac
ctgccacacagcgtcgcctggcgtcagaaagaacaattctctgatggtgttggctatagc
tggattgacaccttgaaagagaaagcagccgagcaagtcactgaccaacagatggaaacc
gctcacttccgcttcccgtacaacacacctggctcgaaagaagggtatttgtaccgtgaa
atctttgaagagctgttcccgctacctagtgcggcggaatgtgtccctggcggcccctct
gttgcctgttcatcagctaaagccattgaatgggatgaatcattcaaaaatatggatgat
ccatcaggccgtgcggttggcgtccatcaggatgcttacaaataa

DBGET integrated database retrieval system