KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_3660Help
Entry
YPC_3660          CDS       T01874                                 

Definition
putative cytochrome C peroxidase (EC:1.11.1.- 1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Brite
Enzymes [BR:yph01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     YPC_3660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3519514..3520893
Genome map
AA seq 459 aa AA seqDB search
MIRRGLIGGGILVIAGYLGIAGYLYMTDNTRNNTFISEAKTPNQQVSNILYQKGCDYCHT
ANASLPFYAAIPGPKQLMDYDIRQGNQHFSLEPTLLALKENRAVPEADLAKIESAIARDQ
MPPQRFNALHWSSSINAEERNQILDWVKIQRTTYFPSNSHSEMQHLALQPIPDALLVDNQ
KVALGSRLFHDPRLSGDNSISCASCHLLNKGGVDNLATSTGVDGQKGGINAPTVFNAVFN
VEQFWDGRAVDLQQQAGGPPLNPVEMASTSWEDIIAKLQQDPQLTQDFAQVYPQGYSEDT
ITDAIAEFEKTLTTPNSPFDHYLKGETQALTTSQQKGLALFQQNKCDTCHVGKNIGGQSY
EFLGLKSDYFADRQKEQTTDDLGRFNVTNDPRDMHRFKTPSLRNIALTAPYFHDAQAKDL
HQAVELMLKYQVGTQLPEQDINDIVAFLESLTGEYIPHS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgataagaagaggattaattggtggcggtatattggtaattgcaggttatctgggtatt
gctggctatctttatatgacagataacacacgtaataacaccttcatcagcgaggcaaaa
acacccaatcagcaggtcagtaatattctttaccaaaaagggtgtgattattgccatacc
gcgaatgcatccctgccattttatgccgctatccccggccctaaacaactgatggactat
gacattcgacaaggtaaccagcatttctcattggagccaacactattagcattaaaagaa
aatcgtgccgttcctgaagcagatttagccaaaatagaatcggctattgctcgcgatcaa
atgccacctcaacgctttaacgcattacattggtcctccagcatcaacgctgaggagcga
aaccagatccttgattgggtcaaaatacaacggacgacatacttcccttccaatagccac
agcgaaatgcagcacttagcactacagccgatccccgatgccttgctggtcgacaaccaa
aaagtggcactaggttcccgcctgttccatgaccccagattatccggtgataactctatt
tcctgtgccagttgccatctgttgaacaaaggaggcgttgataatctggcgacctcaacg
ggtgtcgatggacaaaaaggtgggatcaacgcgcctacggtatttaatgccgtatttaac
gtggagcagttttgggatggccgtgccgttgatttgcagcaacaagccggtggaccacca
cttaacccagtagaaatggcctcgacctcttgggaagatataattgctaaattgcaacaa
gacccacagttgacccaggactttgcccaagtgtatccgcaaggctattctgaagacacg
atcaccgatgcaatcgctgaatttgagaaaaccctgaccacccccaacagccctttcgac
cactatctgaaaggtgaaacacaggcattaacgactagccagcaaaaaggcttggcgcta
ttccagcaaaataaatgtgatacctgccacgtcggtaaaaatattggtgggcagtcctat
gagttcttggggctaaaaagtgactatttcgctgatcgccaaaaagagcaaactaccgat
gacctcgggcgtttcaacgtcaccaacgatccacgcgatatgcaccgctttaaaacaccg
agcttgcgtaatattgccttaacagccccttattttcacgatgcacaagctaaagattta
catcaggcggttgagctaatgctcaaatatcaggtagggacccaactaccagaacaggat
atcaacgatatagtggccttcctggaaagtttgaccggggaatatattcctcattcctga

DBGET integrated database retrieval system